PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0556s0218.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 167aa    MW: 19442.6 Da    PI: 6.2778
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0556s0218.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.82e-1274124555
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L+++l++  ++
  Bostr.0556s0218.1.p  74 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVLET 124
                          79*******************************************997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-1370134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.59972135IPR004827Basic-leucine zipper domain
PfamPF001703.3E-1074131IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.1E-1074147No hitNo description
SuperFamilySSF579596.94E-1274123No hitNo description
CDDcd147021.46E-1775123No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MIPAEITGYF QYLSPEYNII NMPSSPTSSL NYLNDLIINN SNYSSSSNSQ DLMISNNSTS  60
DEDHHQSIII LDERKQRRML SNRESARRSR MRKQRHLDEL WSQVIRLRNE NNCLIDKLNR  120
VLETQDSVLK ENSKLKEEAS DLRKLVSEMN SNKNNNSSFP REFEDI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18693RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAPTransfer from AT2G04038Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071780.0AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010514166.14e-96PREDICTED: basic leucine zipper 43-like
TrEMBLR0H8E49e-89R0H8E4_9BRAS; Uncharacterized protein
STRINGAT2G04038.13e-87(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.12e-85basic leucine-zipper 48