PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0124s0115.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family TCP
Protein Properties Length: 403aa    MW: 44337.8 Da    PI: 7.3317
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0124s0115.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.86.8e-37511672118
                  TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91 
                          +g+kdrhsk++T++g+RdRRvRlsa++a++f+d+qd+LGfd++sk+++WL+++ak ai++l++++  ++ ++  ++   ++++++++k  
  Bostr.0124s0115.2.p  51 TGRKDRHSKVCTAKGPRDRRVRLSAPTAIQFYDVQDRLGFDRPSKAVDWLIKKAKSAIDDLAELPPWNPADTLRQHAAAANAKPRKTKTL 140
                          79**************************************************************44444344333333333334444444 PP

                  TCP  92 ksaakskksqksaasalnlakesraka 118
                           s +++++++++++++++  ++++++ 
  Bostr.0124s0115.2.p 141 ISPPPPQPPPHEETEHRHHLHHHNHQI 167
                          444444444444443333333333222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-3451171IPR005333Transcription factor, TCP
PROSITE profilePS5136934.27253111IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MAANYHLIDS PSPPLLEMRH NQSAFTAAAT ENGGGYGEIV EVEGGHIVRS TGRKDRHSKV  60
CTAKGPRDRR VRLSAPTAIQ FYDVQDRLGF DRPSKAVDWL IKKAKSAIDD LAELPPWNPA  120
DTLRQHAAAA NAKPRKTKTL ISPPPPQPPP HEETEHRHHL HHHNHQIGEE DNESSFLPAS  180
MDSDSIADTI KSFFPVASTQ QSFHQPPSRA NTRNQDLLRL SLQSFQNGPP FADQTEPVLF  240
SGQSTPLGFD SSTAGWDQNH QSPEFGKIQR LVTRNNGGAA DSAGGGGFVF ASPSSFQPVF  300
SQSQILSQRG PLQSINTPMI RAWFDPHHHH HHHHQSMTSD DHHYHHHPYH VPTGIHQSTI  360
PGIALASSGE FSGFRIPARF QGEQEEHGGK NKQSSASSDS RH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-2058111154Putative transcription factor PCF6
5zkt_B4e-2058111154Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00203DAPTransfer from AT1G53230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.0124s0115.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0080070.0AC008007.7 Genomic sequence for Arabidopsis thaliana BAC F12M16 from chromosome I, complete sequence.
GenBankAF0721340.0AF072134.1 Arabidopsis thaliana TCP3 mRNA, complete cds.
GenBankAY0996780.0AY099678.1 Arabidopsis thaliana putative flower development protein cycloidea (At1g53230) mRNA, complete cds.
GenBankBT0002660.0BT000266.1 Arabidopsis thaliana putative flower development protein cycloidea (At1g53230) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304984.10.0transcription factor TCP3
SwissprotQ9MAH80.0TCP3_ARATH; Transcription factor TCP3
TrEMBLR0GPM50.0R0GPM5_9BRAS; Uncharacterized protein
STRINGBostr.0124s0115.1.p0.0(Boechera stricta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53230.11e-176TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3
Publications ? help Back to Top
  1. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  3. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  4. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]