PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0124s0106.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family SBP
Protein Properties Length: 182aa    MW: 20752.2 Da    PI: 9.6334
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0124s0106.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1352.4e-4263138277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv++C+adl+eak yhrrhkvCevh+ka++v++sg++qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
  Bostr.0124s0106.1.p  63 CQVDRCTADLKEAKLYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSS 138
                          **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.2E-601149IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.107.0E-3359124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18860137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3862141IPR004333Transcription factor, SBP-box
PfamPF031102.7E-3263136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MEGQRTQGQG YLKSKSYLVE EEIENDIDGE EEIGRDEEKR KGVMDRVRGS SGSIDRVGSS  60
RLCQVDRCTA DLKEAKLYHR RHKVCEVHAK ASSVFLSGVS QRFCQQCSRF HELQEFDEAK  120
RSCRRRLAGH NERRRKSSGD SFGEGSGRRG ITGQVIQNQE RSRVEMTLPM PNSSFKRPQI  180
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-4849136184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0849021e-160AY084902.1 Arabidopsis thaliana clone 12071 mRNA, complete sequence.
GenBankAJ0116321e-160AJ011632.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 4, partial.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010462181.11e-118PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ9S7A93e-96SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLD7KKE31e-109D7KKE3_ARALL; Squamosa promoter-binding-like protein
STRINGfgenesh2_kg.1__4389__AT1G53160.21e-108(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-94squamosa promoter binding protein-like 4