PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 641aa    MW: 72411.5 Da    PI: 6.3166
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.56e-942676292373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++ L++cAeav+ +d+  a+ lL+r++ ++sp+g++ qRla+yf+++L+arla+++sely++l  + t    ++e ++a++l+  ++ ++k
  Brast10G199600.1.p 267 ETMLIRCAEAVACNDQCSASDLLERIKRHSSPKGNARQRLAHYFAQGLEARLAGTGSELYHSLFGTCTI---TVELMKAYHLYRTICCFIK 354
                         678**********************************************************99777776...799**************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++l  N++I++av+g +++ i+ ++i+ GlQWp L++ La+R++gpp++R+T +  p++g   +e++ee g+rL ++A+++g++f+f+++
  Brast10G199600.1.p 355 VAFLFSNKTIYNAVAGRRKLRIVHYGINTGLQWPDLIRWLADREGGPPEVRMTSITGPQPGfrTSEQIEEAGRRLCNYASKFGMSFKFHAI 445
                         ************************************************************9*99**************************5 PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                                    +L+++p+E+l+Vn+ +q   l+des++ +   + d+vL+++++++P v+v++  +  ++++ F++rf +al+ ++alfd+
  Brast10G199600.1.p 446 ----------ADLDIDPDEVLVVNSLFQFRALMDESLTFDRvnPMDTVLNIIRKIKPYVFVHAVTNGPYSGAFFMTRFRHALYNFTALFDM 526
                         ..........789***********************99887779*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+ +p++ + r  +Er +++r ++n++acega+r+er +++++W+ r ++aG++++pl+ +++ + k+ +++++ + ++++e++ +l++g
  Brast10G199600.1.p 527 METVVPQDYDVRLQLERDVFARCAMNMIACEGADRVERPQNYREWQTRHNRAGLRQLPLDPDIVLTLKRKVKNHYHKHFMINEDHRWLLQG 617
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+rpL+++S W
  Brast10G199600.1.p 618 WKGRPLYALSTW 629
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.662240610IPR005202Transcription factor GRAS
PfamPF035142.1E-91267629IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MATSPEELSE PAPISPSVSL DLPPTTHGDP KQPSQDDLSL AYISRMLMEE DIVDKFSYQY  60
PDHPKLLQTE QPFAQILSAA ATTSSIAQES STPGTLSSAL MPSQDNNKVI IVSGFLFSEV  120
QDPAFLNGTD TVECNSTLFP SESSNSLDML PNMAFFEGMK EANMFLPRDK GMVDVRRRKN  180
RFDMDGETEA GMGRSSKQIA VLVHTDSEEE AELKKILDQL ILNGDDMYAS EMQEVLITLD  240
KESKGAQKSF RMRGRRGLKQ PVVTDLETML IRCAEAVACN DQCSASDLLE RIKRHSSPKG  300
NARQRLAHYF AQGLEARLAG TGSELYHSLF GTCTITVELM KAYHLYRTIC CFIKVAFLFS  360
NKTIYNAVAG RRKLRIVHYG INTGLQWPDL IRWLADREGG PPEVRMTSIT GPQPGFRTSE  420
QIEEAGRRLC NYASKFGMSF KFHAIADLDI DPDEVLVVNS LFQFRALMDE SLTFDRVNPM  480
DTVLNIIRKI KPYVFVHAVT NGPYSGAFFM TRFRHALYNF TALFDMMETV VPQDYDVRLQ  540
LERDVFARCA MNMIACEGAD RVERPQNYRE WQTRHNRAGL RQLPLDPDIV LTLKRKVKNH  600
YHKHFMINED HRWLLQGWKG RPLYALSTWA ADDAGGSELT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-362706298374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EKX50.0A0A0Q3EKX5_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein