PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 651aa    MW: 73236.2 Da    PI: 6.5585
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.91.2e-1012686392373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAeav+s+d + a++lL+++++++sp+g++ qRla+yf ++L+arla+++s+ y++l  +  s   +++ ++a++l+s ++ ++k
  Brast10G199500.1.p 268 ETLLIRCAEAVASNDSRSASELLEQIKQNSSPRGNARQRLAHYFSQGLEARLAGTGSQFYHSLIGTGIS---TVDLVKAYHLYSATCCFVK 355
                         789************************************************************999888...899**************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++l  N++I++av+g +++Hi+ ++i+ G+QWp L++ La+R++gpp++R+T ++ p++g   +e++ee g+rL+++A+elgvpf+f++ 
  Brast10G199500.1.p 356 VAFLFSNKTIYNAVAGRRKLHIVHYGINTGVQWPDLIRWLADREGGPPEMRMTSINIPQAGfhPSEQIEEAGHRLRNYASELGVPFKFHA- 445
                         ***********************************************************9999***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++++ e+++ e+L+++p+E+l+Vn+++q  +l+des++ +   +rd vL+++++++P v+v++  +  ++++ F++rf +al+ ++a fd 
  Brast10G199500.1.p 446 IETKPEAVRAEDLHIDPDEVLVVNSIFQFRTLMDESLTFDRvnPRDMVLNTIRKMKPSVFVHAVTNGPYSAALFMTRFRHALYNFMASFDV 536
                         6999********************************99887779*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+ +pr+++ r  vEr +++r + +++acega+r+er +++++W+ r+++aG+++++l+ +++   k  +++ + + ++++e++ +l++g
  Brast10G199500.1.p 537 METMVPRDNDMRLQVERDIFARCAISMIACEGADRVERPQNYREWQTRIHRAGLRQLRLDPDIVLMLKDKVKNQYHKHFMINEDHRWLLQG 627
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++S W
  Brast10G199500.1.p 628 WKGRVLYALSTW 639
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.459241620IPR005202Transcription factor GRAS
PfamPF035144.2E-99268639IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MAATPEELSG VVEPVPIPPS VFLDHPSTTH GDSKQPQDDL SLAYISRMLM EDDIIDKFSY  60
QYPDHPKLLQ TEKPFAQILS SAATISSGAQ ESSAPGTLAR TLMPSQDNNM DIMVSGFFSC  120
EVQDPAFLNG TYAAGFNSTL FPSDSSSSMD TNMAFFKGMQ EANMFLPRDN GTGMVDGRGR  180
KNRLEIDGEA EAGMGRSSKQ LAMLVHTESE DTTAKKRLDC LILNGYDRYP GEMQEVLIAL  240
EKENKAAEKS IRMRGRRGMK QTVVTDLETL LIRCAEAVAS NDSRSASELL EQIKQNSSPR  300
GNARQRLAHY FSQGLEARLA GTGSQFYHSL IGTGISTVDL VKAYHLYSAT CCFVKVAFLF  360
SNKTIYNAVA GRRKLHIVHY GINTGVQWPD LIRWLADREG GPPEMRMTSI NIPQAGFHPS  420
EQIEEAGHRL RNYASELGVP FKFHAIETKP EAVRAEDLHI DPDEVLVVNS IFQFRTLMDE  480
SLTFDRVNPR DMVLNTIRKM KPSVFVHAVT NGPYSAALFM TRFRHALYNF MASFDVMETM  540
VPRDNDMRLQ VERDIFARCA ISMIACEGAD RVERPQNYRE WQTRIHRAGL RQLRLDPDIV  600
LMLKDKVKNQ YHKHFMINED HRWLLQGWKG RVLYALSTWV AEDTTSSEVT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-422716398374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3H1170.0A0A0Q3H117_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-129SCARECROW-like 14