PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 648aa    MW: 73161.3 Da    PI: 6.6097
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.61.1e-962656362373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAeavs +d   a++lL+r++  +sp+gd++qRla+yf+++L+arla+++s+ly++l  ++     ++e ++a+ l   ++ +++
  Brast10G199400.1.p 265 QTLLIRCAEAVSRNDWGGASELLERIKRYSSPRGDANQRLAHYFAQGLEARLADTGSQLYRSLIGKHLC---TVELVQAYYLHMATCCFVN 352
                         689************************************************************999998...89999************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ l  N +I++av+g +++Hi+ +++  G +Wp L+q L++R++gpp++RiT++++p++g   +e ++e g+rL +fA+++gv+f+f++ 
  Brast10G199400.1.p 353 VAGLFSNCTIYNAVAGRRKLHIVHYGMITGYKWPLLIQRLSDREGGPPEVRITAINNPQPGfrPAEPIHEAGHRLGHFARKFGVTFKFHT- 442
                         **************************************************************9***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +a + e ++ e+L+++p+E+l+Vn+ +q  +l de ++ +   +rd vL+++++++P v++++  + +++++ F++rf +al+ ++alfd+
  Brast10G199400.1.p 443 IAAKPEVVHAEDLHIDPDEVLVVNSLFQFRTLIDECLTFDRvsPRDMVLNTIRKMKPSVFIHAVVNGSYSAAFFMTRFRQALYNFTALFDM 533
                         6999*******************************98877666************************************************ PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +++++pr+++ r ++Er +++++++n++aceg++r+er  ++++W++r ++aG++++pl+ +++   k  l++ + + ++++e++++l++g
  Brast10G199400.1.p 534 MDTTIPRDNNSRLVLERDIFAWSAMNMIACEGTDRVERPHNYREWQARNQRAGLRQLPLDPDIVVMLKDELKNKYHKHFMIDEDHQWLLQG 624
                         ********************************************************************9999999899************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++S W
  Brast10G199400.1.p 625 WKGRVLYALSTW 636
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.635238617IPR005202Transcription factor GRAS
PfamPF035143.8E-94265636IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MAAEPEELVD FIEPAPLPPS IFLDLPPTTH GDSKQPQDDM SLTYISRMLM EDDINDKLSY  60
KHTDHLKLLQ AEQPFAQILS AAANTSLGAQ ECSAPDVVVS ALMPNQDNNK DSTVCGLLSR  120
EVQDPTFLNG TDLVESNSTL FPSENNRSTS MIFFKGMEEA SMLLPKHNGM SDLRGHKNRF  180
GVDGETEASM GRSSKQIAVL VHTDSEEEDT PLKMLDRLIL NGYDKHPGEM QDVLITLDKE  240
NKVAQKSIHR RGRRGATQPV LTDLQTLLIR CAEAVSRNDW GGASELLERI KRYSSPRGDA  300
NQRLAHYFAQ GLEARLADTG SQLYRSLIGK HLCTVELVQA YYLHMATCCF VNVAGLFSNC  360
TIYNAVAGRR KLHIVHYGMI TGYKWPLLIQ RLSDREGGPP EVRITAINNP QPGFRPAEPI  420
HEAGHRLGHF ARKFGVTFKF HTIAAKPEVV HAEDLHIDPD EVLVVNSLFQ FRTLIDECLT  480
FDRVSPRDMV LNTIRKMKPS VFIHAVVNGS YSAAFFMTRF RQALYNFTAL FDMMDTTIPR  540
DNNSRLVLER DIFAWSAMNM IACEGTDRVE RPHNYREWQA RNQRAGLRQL PLDPDIVVML  600
KDELKNKYHK HFMIDEDHQW LLQGWKGRVL YALSTWVADH ASSSNIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-402646365374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575609.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3L3C30.0A0A0Q3L3C3_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-131GRAS family protein