PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 612aa    MW: 69047 Da    PI: 9.3341
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.34.1e-1052296002373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAeav++++ + a++lL r++ ++sp+gd++qRla+yf+e+L+ar+a+ +s+ly+ l +++t+   ++e l+a+klf  ++ +lk
  Brast10G199300.1.p 229 ETLLISCAEAVATNNRRSARELLGRIKWHSSPRGDATQRLAHYFAEGLEARMAGRGSHLYRLLMAKHTP---TVELLKAYKLFMSACCFLK 316
                         789************************************************************999999...9****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +s++  N++I++a++g +++Hi+ ++ + G+QW aLl+ La R++gpp++RiTg+ s ++g   +e++  +g+rL + A+++gvpf++++ 
  Brast10G199300.1.p 317 VSFMFSNKTIYKAIAGRKKLHIVHYGSNDGFQWSALLRCLAGRKGGPPEVRITGITSLRPGfrPAEQIDDIGRRLIECAKKFGVPFKYRA- 406
                         *********************************************************999999***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++ + ed+++e+L+++p+E+l+Vn+ l+  +l+desv +++  +rd vL+++++++P +++++  +a++n++ F++rf + l++++a fd 
  Brast10G199300.1.p 407 IEAKSEDVRVEDLNINPDEVLIVNSLLNFRSLMDESVVIDKlnPRDMVLNTIRKMKPAIFIHAIVNASYNTTFFVTRFRQVLHHFAAHFDI 497
                         6999**********************************999999*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e++++r++++r +vEr +++r+++n++aceg++r+er +++++W++r ++aG++++pl+ +++++ k  +++ + + + v+e++++l++g
  Brast10G199300.1.p 498 METTVSRDNDKRLVVERDIFARSAMNIIACEGTDRVERPQNYREWQARNRRAGLRQLPLDPDIVQTLKDNVKRQYHKHFVVDEDHQWLLQG 588
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++S W
  Brast10G199300.1.p 589 WKGRVLYALSTW 600
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.26202581IPR005202Transcription factor GRAS
PfamPF035141.4E-102229600IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MAAKPIVFLD HPDPSSQPHD NLALDYISRM LMKEDIVDKF LYQFPNHAAL QQAQHPFDQI  60
LSASDTTITS YAQQSSTPNM LASASILPIG NIPNPSFFLN GMDMGEPNRS MDVISSMAFF  120
RGMEEANRFL PTDREMVDGG RLKNGSSHIG DRTSKQMVVQ VLPETEEEAA AGKMLDQLML  180
GGYDTCPTEA RGRRSPTVER DDGVGKQSSS RKALSGRRSM RLAVVADLET LLISCAEAVA  240
TNNRRSAREL LGRIKWHSSP RGDATQRLAH YFAEGLEARM AGRGSHLYRL LMAKHTPTVE  300
LLKAYKLFMS ACCFLKVSFM FSNKTIYKAI AGRKKLHIVH YGSNDGFQWS ALLRCLAGRK  360
GGPPEVRITG ITSLRPGFRP AEQIDDIGRR LIECAKKFGV PFKYRAIEAK SEDVRVEDLN  420
INPDEVLIVN SLLNFRSLMD ESVVIDKLNP RDMVLNTIRK MKPAIFIHAI VNASYNTTFF  480
VTRFRQVLHH FAAHFDIMET TVSRDNDKRL VVERDIFARS AMNIIACEGT DRVERPQNYR  540
EWQARNRRAG LRQLPLDPDI VQTLKDNVKR QYHKHFVVDE DHQWLLQGWK GRVLYALSTW  600
VADDASSSEV T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-452326008374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575610.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH410.0A0A0Q3EH41_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-142GRAS family protein