PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 620aa    MW: 70311.9 Da    PI: 6.9295
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.92.9e-1022376092374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAeav+s+d + a +lL+r++  +sp+gd+ qR+a+yf ++L+arla+++++ y+  + ++ts   + e ++a+++   ++ +++
  Brast10G199200.1.p 237 ETLLIRCAEAVASNDRRSAAELLERIKRYCSPTGDARQRVAHYFSQGLEARLAGTGTQFYRLSTGTRTS---TLELVKAYHMHMATCCFIT 324
                         789***************************************************999999755555555...8999*************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ l  N +I++ v+g +++Hi+ ++i+ G QWp L++ L++R++gpp++RiTg+++p++g   +  +ee g+rL+++A+++gvpf+f++ 
  Brast10G199200.1.p 325 VALLFSNDTIYKTVAGRRKLHIVHYGINTGYQWPKLIRRLTDREGGPPEVRITGINRPQPGfrPAGLIEEAGDRLSNYANKFGVPFKFHA- 414
                         *************************************************************9999999**********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +a + e+++ e+++++p+E+l+Vn+++   +l+des++l++  +rd vL+++++++P v+v++  + +++++ F++rf +al+y++alfd+
  Brast10G199200.1.p 415 IAAEPEAVRAEDIHIDPDEVLVVNSIFDFRTLMDESLTLDEvnPRDMVLNTIRKMKPSVFVHAVVNGSYSAAFFMTRFRQALYYFTALFDM 505
                         6999**********************************998889*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+++p+++++r+ vEre+++r+++n++acega+r+ r  ++++W++r ++aG++++pl+++ +   k  +++ + + ++++e++++l++g
  Brast10G199200.1.p 506 METTFPEDNNKRVLVEREIFARSAMNMIACEGADRVDRPHNYKEWQARNQRAGLRQMPLNHDLVLMLKEEVKNQYHKNFMINEDHQWLLQG 596
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk++ L+++S W+
  Brast10G199200.1.p 597 WKGQVLYALSTWT 609
                         ************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.561210589IPR005202Transcription factor GRAS
PfamPF035141.0E-99237609IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MPPTTHGAQP PPNDLSLAYI SRILMEEDIA DKFSYQYPDS PKLLQAEQPF AQILSAAATA  60
SFGTQESSVP SMPASALMPS QDNKTDIKIQ DPALLIGTER ETAEPHSTLF SSERSTSMDE  120
LSSMAFFKGI EDASMFLPRD NGMVDGRVRK NRFDVDGETE AGMERSRKQI AVLHTVSEDE  180
DIALKMLDRL VLNGYDKRPG EMREVRATLY KENKASQKSI RMRRRRGAKQ MVVTDLETLL  240
IRCAEAVASN DRRSAAELLE RIKRYCSPTG DARQRVAHYF SQGLEARLAG TGTQFYRLST  300
GTRTSTLELV KAYHMHMATC CFITVALLFS NDTIYKTVAG RRKLHIVHYG INTGYQWPKL  360
IRRLTDREGG PPEVRITGIN RPQPGFRPAG LIEEAGDRLS NYANKFGVPF KFHAIAAEPE  420
AVRAEDIHID PDEVLVVNSI FDFRTLMDES LTLDEVNPRD MVLNTIRKMK PSVFVHAVVN  480
GSYSAAFFMT RFRQALYYFT ALFDMMETTF PEDNNKRVLV EREIFARSAM NMIACEGADR  540
VDRPHNYKEW QARNQRAGLR QMPLNHDLVL MLKEEVKNQY HKNFMINEDH QWLLQGWKGQ  600
VLYALSTWTV DDTSGSEET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-422406088374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575611.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH210.0A0A0Q3EH21_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-138GRAS family protein