PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 606aa    MW: 68323.7 Da    PI: 6.9954
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3342.8e-1022255972374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAeavss+d++ a++lL r++ ++sp+gd+ qRla+yf+++L+ar+a+++s+ly +l  ++ts   + e ++a++l   ++ +lk
  Brast10G199100.1.p 225 ETLLIRCAEAVSSNDQRSASELLDRIKRHSSPTGDARQRLAHYFAQGLEARMAGTGSQLYGSLIGTHTS---TLELIKAYHLHMATCCFLK 312
                         789***********************************************************9988888...89***************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ +  N +I++av+g +++Hi+ ++i+ G QW+ L++ La+R++gpp++RiTg++sp++g   +e +ee g+rL+k+A+++gv+f+f++ 
  Brast10G199100.1.p 313 VALIFSNYTIYNAVAGRRKLHIVHYGINTGYQWARLIRRLADREGGPPEVRITGINSPQPGfrPAELIEEAGRRLSKYARKCGVSFKFHA- 402
                         **************************************************************9999************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         va + e+++ e+L+++p+E+l+V + +   +l+des++ +   +rd vL++++ ++P v+v++  + +++++ +++rf +al++++alfd 
  Brast10G199100.1.p 403 VAAKPEAVRAEDLHIDPDEVLVVDSLFDFRTLMDESLTFDRanPRDVVLNTIRMMKPSVFVHAIVNGSYSAAFYMTRFRQALYFFTALFDV 493
                         7999********************************99877669*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+++pr++++r  +Er +++r+++n++aceg+er+er +++++W++r ++aG++++pl+ +++   k  +++ + + ++++e++g+l++g
  Brast10G199100.1.p 494 METTIPRDNDKRLLLERDIFARSAMNMIACEGTERVERPQNYREWQARNQRAGMRQLPLDPDIVLMLKEKVKNQYHEHFMINEDHGWLLQG 584
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r L+++  W+
  Brast10G199100.1.p 585 WKGRVLYALATWT 597
                         ************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.793198577IPR005202Transcription factor GRAS
PfamPF035149.8E-100225597IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MTHGDSNQPQ DGLSLAYISR MLMEDDIIDK FSYQYPDHPK LLQAEQPFAQ ILTSTASTSS  60
DAEESTASNT ISTALLPSMV QDPAFFSNGT DAVGPSSTLF SIESSTNMNK VSSMAFFKGM  120
EEAKMFLPRE NLMVYGRGLK NRFDMDGETE AGMGRSSKQI ALVDTDSEDT ALNMLDRLIL  180
NEYDGYRGEM HEVLITLQNE NKAAQQSIRT RGRRGAKKTM VTDLETLLIR CAEAVSSNDQ  240
RSASELLDRI KRHSSPTGDA RQRLAHYFAQ GLEARMAGTG SQLYGSLIGT HTSTLELIKA  300
YHLHMATCCF LKVALIFSNY TIYNAVAGRR KLHIVHYGIN TGYQWARLIR RLADREGGPP  360
EVRITGINSP QPGFRPAELI EEAGRRLSKY ARKCGVSFKF HAVAAKPEAV RAEDLHIDPD  420
EVLVVDSLFD FRTLMDESLT FDRANPRDVV LNTIRMMKPS VFVHAIVNGS YSAAFYMTRF  480
RQALYFFTAL FDVMETTIPR DNDKRLLLER DIFARSAMNM IACEGTERVE RPQNYREWQA  540
RNQRAGMRQL PLDPDIVLML KEKVKNQYHE HFMINEDHGW LLQGWKGRVL YALATWTVDH  600
ASGPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-392285968374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575612.30.0PREDICTED: scarecrow-like protein 33
TrEMBLI1IJ190.0I1IJ19_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-141GRAS family protein