PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G199000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 629aa    MW: 70549.5 Da    PI: 7.244
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G199000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.63.6e-1022476192374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         + lL++cAeav+s+d++ a++lL+r++ ++sp+gd+ qRla+yf+++L+arla++ s+ly++l  s++s   ++e ++a++l++ +s ++k
  Brast10G199000.1.p 247 EMLLIRCAEAVASNDKRSASELLERIKWHSSPTGDARQRLAHYFAQGLEARLAGTRSRLYSSLMGSHNS---TVELMKAYHLYVTTSCFVK 334
                         579**********************************************************99998888...89***************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ l  N++I++av+g +++Hi+ ++i  G QWp L++ La+R++gpp++RiT ++ p+++   +e++ee ++rL+ +A+++gv+f+f++ 
  Brast10G199000.1.p 335 MALLFSNKTIYNAVAGRKKLHIVHYGIDTGSQWPKLIRWLADRDGGPPEVRITNINTPRPKcrLSEQIEEPEHRLSTYASKFGVSFKFRA- 424
                         ***********************************************************9998899************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +a + e+++ e+L+++p+E+l+Vn+++q  +l+des+  +   +rd vL+++++++P v+v++  + +++++ F++rf ++l+y++alfd 
  Brast10G199000.1.p 425 IAAKPEAVQAEDLQIDPDEVLVVNSIFQFRTLMDESLRFDRvsPRDMVLNTIRKMKPSVIVHAIANGSYSTAFFMTRFRQTLYYFTALFDV 515
                         6999********************************9988777************************************************ PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+ +pr+s++r  vEr +++++++n++acega+r+er +++++W++r ++aG++++pl+++++   k   +++  + ++++e++++l++g
  Brast10G199000.1.p 516 METAIPRDSNKRLLVERDIFAQSAMNIIACEGADRVERPQNYREWQARNNRAGLRQLPLDQDIVLMLKDEAKNHCHKHFMINEDHQWLLQG 606
                         ***********************************************************************9999899************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r L+++S W+
  Brast10G199000.1.p 607 WKGRVLYALSTWT 619
                         ************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.303220599IPR005202Transcription factor GRAS
PfamPF035141.2E-99247619IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MAATPEELLG VIESAPPPVF LDLAPASHGD SKQPQDDLSL AYISRMLMED DIVDLPDDLK  60
LLQAEQPFAQ ILCAAATTSS KADESSSHGT LASALLPSKV QDPAFCLNGT GSVKHSSTLF  120
PIESSTGMIK MPSIAFLKGM DEANMLLPRD NVMVGGRGRR NRFDMDGETE AGMGRSRKQI  180
ALVDTDSEED ATTVAMLDRL ILNAYDMHPS EMQEVRVTLD KENKVAQKST CRRGRRGARQ  240
TVVTDLEMLL IRCAEAVASN DKRSASELLE RIKWHSSPTG DARQRLAHYF AQGLEARLAG  300
TRSRLYSSLM GSHNSTVELM KAYHLYVTTS CFVKMALLFS NKTIYNAVAG RKKLHIVHYG  360
IDTGSQWPKL IRWLADRDGG PPEVRITNIN TPRPKCRLSE QIEEPEHRLS TYASKFGVSF  420
KFRAIAAKPE AVQAEDLQID PDEVLVVNSI FQFRTLMDES LRFDRVSPRD MVLNTIRKMK  480
PSVIVHAIAN GSYSTAFFMT RFRQTLYYFT ALFDVMETAI PRDSNKRLLV ERDIFAQSAM  540
NIIACEGADR VERPQNYREW QARNNRAGLR QLPLDQDIVL MLKDEAKNHC HKHFMINEDH  600
QWLLQGWKGR VLYALSTWTV DDSGGSEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-412506188374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575614.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3H1200.0A0A0Q3H120_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-123GRAS family protein