PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 673aa    MW: 75477.8 Da    PI: 6.3205
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.11.1e-982926631373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+ lLl+cA+ v+ ++++ a +lL++++++as +gd+ qRla++f+++L+ar+a+++s++yk+l +++ts    +e l  ++lf  ++ + 
  Brast10G198900.1.p 292 LRALLLSCAQEVAISNHQGAAKLLKQIRQHASATGDAAQRLAHCFAKGLEARMAGTGSKVYKSLVAKQTS---AIEFLRGYELFMAACSFR 379
                         5789*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         +++      +I  a+ g++r+Hi+D+++++G QWp Ll  La R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++g+pf+f++
  Brast10G198900.1.p 380 RVALTFSSMTIFHAMRGKSRLHIVDYGVNYGCQWPGLLCWLAGRDGGPPEVRITGIDLPQPGfrPAKRIEETGQRLRNCARQFGLPFKFHA 470
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          +a ++e++ +e+L+++p+E+l+Vn  ++  +l+des+ ++   +rd vL+++++++P v++    + +  ++ Fl+rf eal ++s++fd
  Brast10G198900.1.p 471 -IAAKWETIGVEDLNIDPDEVLVVNDLFNFNTLMDESLVTDRpsPRDVVLSTIRGMRPAVFIQGVVNGSS-GPFFLARFREALFFHSSVFD 559
                         .799*********************************98776669****************998888776.89****************** PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                         +l+a+ prese+r ++Er ++g+ + n++acega+r+er et+++W+ r ++aG++++pl+  +++ a + ++ ++ + + v+ ++g+l++
  Brast10G198900.1.p 560 MLDATTPRESEHRLVLERDMFGQCALNAIACEGADRVERPETYKQWQLRNRRAGLRQLPLRPIVVEVATSKVKSMYHKDFVVDVNQGWLLQ 650
                         ****************************************************************************888************ PP

                GRAS 361 gWkdrpLvsvSaW 373
                         gWk+r L++ SaW
  Brast10G198900.1.p 651 GWKGRILYAHSAW 663
                         ************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.271266644IPR005202Transcription factor GRAS
PfamPF035143.8E-96292663IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MESIRPSLYK SDKLISHVLV ECRTITSSEF TMMPITPEEL LETVPPSPSA YLDIPLSPYG  60
DSVGDMVLPY ISRILMEEDI DDMFFYQYPD HPALLRAQQP FVEILNEARN LQSSEGGYIE  120
RMNFDASLQG GRGGSMFLAG KDIQSRAIFD AAEVDNHGDQ SKHSLYNEDM LNMSFLKGME  180
EANKFLPRDN KLQVSSFSVG QPRETFERSA SGRRRCDDGE EVVGRASKLM VTELEEDGAH  240
EMFEKAMLNS CDLNGETMEK LHTDMENAEA NRRNKKAVRG RQQGKRGDTV DLRALLLSCA  300
QEVAISNHQG AAKLLKQIRQ HASATGDAAQ RLAHCFAKGL EARMAGTGSK VYKSLVAKQT  360
SAIEFLRGYE LFMAACSFRR VALTFSSMTI FHAMRGKSRL HIVDYGVNYG CQWPGLLCWL  420
AGRDGGPPEV RITGIDLPQP GFRPAKRIEE TGQRLRNCAR QFGLPFKFHA IAAKWETIGV  480
EDLNIDPDEV LVVNDLFNFN TLMDESLVTD RPSPRDVVLS TIRGMRPAVF IQGVVNGSSG  540
PFFLARFREA LFFHSSVFDM LDATTPRESE HRLVLERDMF GQCALNAIAC EGADRVERPE  600
TYKQWQLRNR RAGLRQLPLR PIVVEVATSK VKSMYHKDFV VDVNQGWLLQ GWKGRILYAH  660
SAWVADDSSS DD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-402966638374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238971.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1IJ200.0I1IJ20_BRADI; Uncharacterized protein
STRINGBRADI4G09160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-133SCARECROW-like 14