PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 659aa    MW: 73885.9 Da    PI: 5.5654
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.84.6e-972796492373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         +  Ll c + v++g+++ a+ lL++++++as +gd+ qRla++f+++L+arla+++s++y++l  ++ts   + e l+ ++lf  ++P+ +
  Brast10G198800.1.p 279 RGMLLCCSQEVATGNHQGAHILLKQIRQHASARGDAAQRLAHCFAQGLEARLAGTGSQVYRSLVEKHTS---TMEFLKGYELFMAACPFKR 366
                         56899**********************************************************999999...899**************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++     +I +aveg++r+Hi+D+++ +G QWp Ll  La+R + pp++RiTg++ p++g   +++++etg+ L++ A+++++pf+f++ 
  Brast10G198800.1.p 367 VAFTFSSMTIFNAVEGKSRLHIVDYGLHYGCQWPGLLCWLANRGGRPPEVRITGIDLPQPGfrPSKRIQETGQHLSNCARQFRLPFKFHA- 456
                         ************************************************************9*****************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++ ++e+++ e+L+++p+E+l+Vn  ++  +l+des+ ++   +rd vL+++++++P+v++    + +  ++ Fl+rf eal ++s++fd+
  Brast10G198800.1.p 457 ITAKWETIRAEDLNIDPEEVLVVNELFNFNTLMDESLVTDRpsPRDVVLSTIRGMRPDVFIQGVVNGSS-GPFFLARFREALFFHSSVFDM 546
                         6999********************************98776669****************998888776.89******************* PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a+ pr+se+r ++Er ++g+ + n+vacega+r+er et+++W+ r ++aG++++p + ++++ a   ++  + + + v+ ++g+l++g
  Brast10G198800.1.p 547 LDATTPRDSEHRLVLERDMFGQCALNAVACEGADRVERPETYKQWQLRNQRAGLRQLPSKPSVVEVATDKVKSLYHKDFLVDVDQGWLLQG 637
                         ***************************************************************************888************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L++ SaW
  Brast10G198800.1.p 638 WKGRILYAHSAW 649
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.815252630IPR005202Transcription factor GRAS
PfamPF035141.6E-94279649IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MECSAITSSE FNTMPITSEE LLGLTESVPP SPSVYLDIPP TPYDASVGDL VLPYIARILM  60
EEDIDDRFFY QYPNHPALLR AQQPFAEILE ETKNLLSSEG GDMERMNSDA SLQGARGGSM  120
FLAGKEDIQS WAILDGAEVE NNGDQRKLSL CNEDMLNLAF LKGMEEANKF LPRDNSLQAG  180
AFSIGQAREM LLVRSASGRR RCDDGEEVVG RASKLMVLEL EEDGAHELLE KLMLNSCEFR  240
GEAMQKLRIT MEKTEAERRS MKAGRGRQQR NRGDSVDLRG MLLCCSQEVA TGNHQGAHIL  300
LKQIRQHASA RGDAAQRLAH CFAQGLEARL AGTGSQVYRS LVEKHTSTME FLKGYELFMA  360
ACPFKRVAFT FSSMTIFNAV EGKSRLHIVD YGLHYGCQWP GLLCWLANRG GRPPEVRITG  420
IDLPQPGFRP SKRIQETGQH LSNCARQFRL PFKFHAITAK WETIRAEDLN IDPEEVLVVN  480
ELFNFNTLMD ESLVTDRPSP RDVVLSTIRG MRPDVFIQGV VNGSSGPFFL ARFREALFFH  540
SSVFDMLDAT TPRDSEHRLV LERDMFGQCA LNAVACEGAD RVERPETYKQ WQLRNQRAGL  600
RQLPSKPSVV EVATDKVKSL YHKDFLVDVD QGWLLQGWKG RILYAHSAWV ADDTSSDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-382826498374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575617.30.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0Q3EKY50.0A0A0Q3EKY5_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI4G09170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-129GRAS family protein