PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 584aa    MW: 66016.8 Da    PI: 5.9472
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS312.87.4e-962095782373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+av + d + a +lL++++++asp+gd+ qRla  f+e+L+ rla+++ ++y  l++++ts      ++ a+++f  ++ + +
  Brast10G198700.1.p 209 HTLLVHCAKAVMD-DRQSAGELLKEIKQHASPTGDAAQRLAYWFAEGLEVRLAGTGRQVYGLLKAESTS---ALARMEAYQAFMSTCCFRR 295
                         679********97.8999******************************************999999998...8999*************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++l aN+aI + + g +r+Hi+D+++ +G+QW  Ll+ La+R++gpp++RiT ++ p++g   +++++e+g+ L+++A+ lgvpf++++ 
  Brast10G198700.1.p 296 VAFLFANKAIFNVALGRSRLHIVDYGLRYGFQWQELLRWLAARDGGPPEVRITHIDIPQPGfhPEKQMKEMGDWLTDIARDLGVPFKYRA- 385
                         ************************************************************999***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         v  +++++ +e+L+++p+EalaVn  ++  +l+desv ++s  +rd+vL+ + +++P+v+v +  + ++ ++ Fl rf eal y+sa+fd+
  Brast10G198700.1.p 386 VLAQWQTVCIEDLDMEPDEALAVNDLFNFRTLMDESVVIASpnPRDAVLSNITKMKPDVFVQCIVNGSY-GTFFLSRFREALFYHSAVFDM 475
                         7999*********************************9998889*************************.789****************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a++pres+ r  +Er ++g+ + n++a eg++r+er et+++W+ r ++aG++++pl+ +++k a+ ++++ + + + ++e++++l++g
  Brast10G198700.1.p 476 LDATMPRESRLRLALERDVFGWVALNAIAYEGEDRVERGETYKHWQVRNQRAGLRQLPLDRETVKMARDMVKNDYHKDFVIDEDHQWLLQG 566
                         *************************************************************************99888************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+  S W
  Brast10G198700.1.p 567 WKGRILYGHSTW 578
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.857182559IPR005202Transcription factor GRAS
PfamPF035142.6E-93209578IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MAAPPVFPDL PLTTHGDGYN DRSTLQDHLA LPYITRILME EEDDVDDDHP ALLHAQQPFA  60
QILHSSSTLA SALLADQGDV LAGDTSSPSS AIFKFKGADE VGSLLLLADK EYRMDMFSTA  120
FLKGMEEANR FLPANNKLTS DSQDKGNEKS GRGRKDRHDE LDVEIGRTSK LVEARACEVF  180
DQMRGAVDNE SGNNNKKGRK NKVHVVDLHT LLVHCAKAVM DDRQSAGELL KEIKQHASPT  240
GDAAQRLAYW FAEGLEVRLA GTGRQVYGLL KAESTSALAR MEAYQAFMST CCFRRVAFLF  300
ANKAIFNVAL GRSRLHIVDY GLRYGFQWQE LLRWLAARDG GPPEVRITHI DIPQPGFHPE  360
KQMKEMGDWL TDIARDLGVP FKYRAVLAQW QTVCIEDLDM EPDEALAVND LFNFRTLMDE  420
SVVIASPNPR DAVLSNITKM KPDVFVQCIV NGSYGTFFLS RFREALFYHS AVFDMLDATM  480
PRESRLRLAL ERDVFGWVAL NAIAYEGEDR VERGETYKHW QVRNQRAGLR QLPLDRETVK  540
MARDMVKNDY HKDFVIDEDH QWLLQGWKGR ILYGHSTWVA ERT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-412125788374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3L3D20.0A0A0Q3L3D2_BRADI; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-122SCARECROW-like 14