PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 602aa    MW: 66809.2 Da    PI: 6.8745
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.43.8e-1052115822373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lLl+cA+avs+++++ a++lL+++++++sp+gd+ qRla+yf  +L+arla+ +s+ly++l +++ts   ++++l+a++l+  ++ + k
  Brast10G198600.1.p 211 HTLLLQCAQAVSTDNQRGASELLKKIKQNSSPTGDAAQRLAHYFSVGLEARLAGRGSRLYESLMARRTS---VVDALKADQLYMAACCCKK 298
                         679***************************************************************999...******************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++++ aN++I +av+g +r+Hi+D++i+ GlQWp Ll+ La+R++gpp++RiTg++ p++g   ++ +e tg+rL+++A+++gvpf+f + 
  Brast10G198600.1.p 299 VAFVFANKTICNAVAGRSRLHIVDYGINLGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfrGADHIEDTGRRLSNIARAFGVPFKFCA- 388
                         ************************************************************9*9***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +a + e++++e+L+++p+E+l+V +  +   l+de++  +s  +rd+vL+ +++++P+v+++   + +++++ Fl+rf eal +ysa fd 
  Brast10G198600.1.p 389 IAAKRETVRPEDLNIDPDEVLVVISLCHFRLLMDENLGFDSpsPRDQVLNNIRNMRPNVFIHGILNGSYGATYFLTRFREALFHYSAQFDL 479
                         69999******************************998877779*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a++pr++  r  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG++++pl+ ++++ +   +r  + + + v+e++ +lv  
  Brast10G198600.1.p 480 LDATVPRDNTGRLLLERDIFGRSALNVIACEGADRVERPETYKQWQLRNHRAGLSQLPLNPEVVNLVLDKVRGNYHKNFVVDEDQRWLVHR 570
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++SaW
  Brast10G198600.1.p 571 WKGRVLYALSAW 582
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.872184563IPR005202Transcription factor GRAS
PfamPF035141.3E-102211582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MALPYISRLL MEEEDMADHF FYLYPQHPAL LRAQLPFAQI LEDNSSAGSA TAPSPSSSDS  60
SSASPHDAAQ ISRPPSCSPD GLLPGGAFPK DMLNLAFLKG MEEARKFLPH NTGLPPVVAA  120
AEEDGLLKKK RAYSEPEEVG RASKLMAPEL EEEEDGAREL LDEMMLDENE ICMKGVQNLQ  180
VAEPVKKTRK GTGQRGRPRK AAVDGEMVDL HTLLLQCAQA VSTDNQRGAS ELLKKIKQNS  240
SPTGDAAQRL AHYFSVGLEA RLAGRGSRLY ESLMARRTSV VDALKADQLY MAACCCKKVA  300
FVFANKTICN AVAGRSRLHI VDYGINLGLQ WPGLLRMLAA REGGPPEVRI TGIDLPQPGF  360
RGADHIEDTG RRLSNIARAF GVPFKFCAIA AKRETVRPED LNIDPDEVLV VISLCHFRLL  420
MDENLGFDSP SPRDQVLNNI RNMRPNVFIH GILNGSYGAT YFLTRFREAL FHYSAQFDLL  480
DATVPRDNTG RLLLERDIFG RSALNVIACE GADRVERPET YKQWQLRNHR AGLSQLPLNP  540
EVVNLVLDKV RGNYHKNFVV DEDQRWLVHR WKGRVLYALS AWVADEPPSL FSQSNFNYVS  600
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-422145828374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232237LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLA0A0Q3EH460.0A0A0Q3EH46_BRADI; Uncharacterized protein
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-130SCARECROW-like 14