PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 622aa    MW: 69312.8 Da    PI: 6.2557
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS337.91.8e-1032446152373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lLl+cA+avs++d++ a +lL+++++++s +gd+ qRla+yf  +L+arla+ +sely++l +++ts   ++++l+a +l   ++ + k
  Brast10G198500.1.p 244 HTLLLQCAQAVSTDDKQGAGELLKKIKQNSSTTGDAAQRLAHYFSVGLEARLAGRGSELYESLMVQRTS---VVDVLKANQLHMAACCCRK 331
                         679***************************************************************999...******************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +s++   ++I++av+g +r+Hi+D++i+ GlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +e tg+rL++fA+ +gvpf+f+  
  Brast10G198500.1.p 332 VSFFFSDKTIYNAVAGRSRLHIVDYGINLGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfrGAYHIEDTGRRLSNFARVFGVPFKFRG- 421
                         ************************************************************999999************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +a + e++++e+L+++p+E+l+V +  +  +l+de++  +s  +rd+vL+ +++++P+v+++     +++++ Fl+rf eal +ysa fd 
  Brast10G198500.1.p 422 IAAKRETVRPEDLNINPDEVLVVVSLCHFRHLMDENLGFDSpsPRDQVLNNIRKMRPDVFIHGILSGSYGATYFLTRFREALFHYSAHFDQ 512
                         69999*******************************98887779*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l++++pr+++ r  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  + + + v+e++ +lv+ 
  Brast10G198500.1.p 513 LDVTVPRDNHGRLLLERDIFGRSALNVIACEGADRVERPETYKQWQLRNHRAGLSQLPLNPEVVKLVLDKVKDNYHKDFVVDEDQRWLVQR 603
                         *************************************************************************99888************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++SaW
  Brast10G198500.1.p 604 WKGRVLYAMSAW 615
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.194217596IPR005202Transcription factor GRAS
PfamPF035146.1E-101244615IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MAGGATPEEE FLRQSFLARL EPPSPSLFLD LPPTPRAAAG EAGSSSSSFD DMVLPYISQL  60
LMEEEDMADH FFYLYPQHPA LLRAQLPFAQ ILEDNSSAGS APTPSSSDSS SPADGCPELR  120
AVQSSALPNQ DMLNLAFLKG MEEARKFLPV VAAAEEDGLL KKKRGNSEPE EEGRASKLMA  180
PELEEEDDGA RELLDEMMFD EKEICMKGVQ NLQVAEPVKK SRKGTRQRGR QKKAAVDGEM  240
VDLHTLLLQC AQAVSTDDKQ GAGELLKKIK QNSSTTGDAA QRLAHYFSVG LEARLAGRGS  300
ELYESLMVQR TSVVDVLKAN QLHMAACCCR KVSFFFSDKT IYNAVAGRSR LHIVDYGINL  360
GLQWPGLLRM LAAREGGPPE VRITGIDLPQ PGFRGAYHIE DTGRRLSNFA RVFGVPFKFR  420
GIAAKRETVR PEDLNINPDE VLVVVSLCHF RHLMDENLGF DSPSPRDQVL NNIRKMRPDV  480
FIHGILSGSY GATYFLTRFR EALFHYSAHF DQLDVTVPRD NHGRLLLERD IFGRSALNVI  540
ACEGADRVER PETYKQWQLR NHRAGLSQLP LNPEVVKLVL DKVKDNYHKD FVVDEDQRWL  600
VQRWKGRVLY AMSAWVAGNA I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-422476158374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265270LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575619.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014758577.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014758578.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014758579.10.0PREDICTED: scarecrow-like protein 9 isoform X1
TrEMBLI1IJ230.0I1IJ23_BRADI; Uncharacterized protein
STRINGBRADI4G09190.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-136GRAS family protein