PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 757aa    MW: 83168.5 Da    PI: 5.3173
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.39.7e-993687461373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++ L++cA+av++gd++    lLa++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   ++e l a+kl+  +s + 
  Brast10G198300.1.p 368 LRTMLIHCAQAVATGDHRSSADLLAQVKQHCSPKGDATQRLAYCFAEGLEARLAGTGSQVYQSLMAKRTS---VVEYLRAYKLYMAASSFK 455
                         5789************************************************************999999...****************** PP

                GRAS  92 kfshltaNqaIleav...egeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                         k+      + I++a+   +g +r+Hi+D+++++G+QWp Llq L++R++gpp++RiTg++ p++g   + ++eetg+rL++ A+e+gvpf+
  Brast10G198300.1.p 456 KVNMAFVGKIIVDAMvsgKGRDRLHIVDYNVQYGFQWPGLLQLLSTREGGPPEVRITGIDLPQPGfrPAFQIEETGRRLTDCAREFGVPFK 546
                         **************9433445*******************************************999************************ PP

                GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                         f+  +a ++e+++ e+++++p+E l+V ++    +lldesv ++      +rd vL+ + +++P+v + +  +  ++++ F++rf eal+y
  Brast10G198300.1.p 547 FHG-IAAKWETVRAEDININPDEFLVVTSQAGFGNLLDESVVMDRqdipsPRDMVLSNIGKMRPDVYIDCVVNGTYGAPFFVTRFREALYY 636
                         ***.799******************************99987766556669**************************************** PP

                GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                         ysa fd+l+a++pr+++er  +Er ++gr + nvvacega+r+er et+++W+ r ++aG++++pl  +++k ++  +++++ + + ++ +
  Brast10G198300.1.p 637 YSAQFDMLDATIPRDNDERLLIERDIFGRCALNVVACEGADRVERPETYKQWQVRGHRAGMRQLPLCPEVVKVVRDKVKNYYHKDFVIDVD 727
                         **********************************************************************************889****** PP

                GRAS 355 sgslvlgWkdrpLvsvSaW 373
                         + +l++gWk+r L+++S W
  Brast10G198300.1.p 728 NRWLLQGWKGRVLYAMSTW 746
                         ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.006342727IPR005202Transcription factor GRAS
PfamPF035143.4E-96368746IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MAAMAPEEFL RPRDRGAAAA FHHFAAAHDA EEEEEEEPPM SPSLFLDLPA TPAPVEQELE  60
FISRMLMEED IDDKFFYQYP DHPAILSAHR AFAQVISTAD SNSNSNSSSS SSSAAARSTT  120
TATSSSSSSG SPDALSAWPC ESPIELSQLI RSPPSADLSV DSDAALPKGS GAVDHNGTAS  180
AVPAEKQKNG SSKLVVAATF PAAGSDGAFT ASAFFNGLVE GGGEMDDMLS LAFRKGMEEA  240
NKFLPRFITG AGQVAEKEAA DGLGTLMFGS TNNGRGRKHR HPDDDQPEPE GRSRKIMAPE  300
PEEVGTDARH MFDEIMLHDY DSFMKGMEDL RLAMGSDAER NARKGTGNGK AARRGKRRGA  360
ASEPEVDLRT MLIHCAQAVA TGDHRSSADL LAQVKQHCSP KGDATQRLAY CFAEGLEARL  420
AGTGSQVYQS LMAKRTSVVE YLRAYKLYMA ASSFKKVNMA FVGKIIVDAM VSGKGRDRLH  480
IVDYNVQYGF QWPGLLQLLS TREGGPPEVR ITGIDLPQPG FRPAFQIEET GRRLTDCARE  540
FGVPFKFHGI AAKWETVRAE DININPDEFL VVTSQAGFGN LLDESVVMDR QDIPSPRDMV  600
LSNIGKMRPD VYIDCVVNGT YGAPFFVTRF REALYYYSAQ FDMLDATIPR DNDERLLIER  660
DIFGRCALNV VACEGADRVE RPETYKQWQV RGHRAGMRQL PLCPEVVKVV RDKVKNYYHK  720
DFVIDVDNRW LLQGWKGRVL YAMSTWVAAD DDKSRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-383727468374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758864.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1IJ240.0I1IJ24_BRADI; Uncharacterized protein
STRINGBRADI4G09197.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein