PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G198000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 586aa    MW: 65937 Da    PI: 8.4458
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G198000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS320.53.6e-982035752374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cAea+s +d ++a+++L+r++ ++sp+gd+ qRla+yf+++L+arla+++sely +l  ++ts   + e ++a++l   ++ +++
  Brast10G198000.1.p 203 DTLLIRCAEAISRNDRRNASEVLERIKWHSSPRGDARQRLAHYFAQGLEARLAGTGSELYCSLIGKHTS---TLELVQAYHLQMATCCFVN 290
                         679*********************************************************999999998...899999************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ l  N +I++av+g +++Hi+ +++  G +Wp L+q La R++gpp++RiT++++pe+g   +e ++e g+rL+  A+++gvpf+fn+ 
  Brast10G198000.1.p 291 VASLFSNYTIYNAVAGRRKLHIVHYGVITGYKWPELIQRLAGREGGPPEVRITAINNPEPGfrPAELIKEAGHRLSACASKFGVPFKFNA- 380
                         ************************************************************9*9999************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         va +le+++ e+L+++p+E+l+V++ +q  ++ld+s++ ++  +rd vL+++++++P v+v++  + +++++ F++rf +al+y++alfd+
  Brast10G198000.1.p 381 VAAKLESVQAEDLHIDPDEVLVVHSLFQFRTMLDDSLTGNKvnPRDMVLNTIRKMKPSVFVHAVVNGSYSAAVFMTRFRQALYYFTALFDM 471
                         799********************************999888779*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +++ +pr +++r+ vEr  +++++ n++aceg++r+er +++++W+++  +aG++++pl+++++ + k  +++ ++  ++v e++ +++lg
  Brast10G198000.1.p 472 MDTAIPRGNDKRMLVERDSFAWSAINMIACEGTDRVERPQNYREWQAQNLRAGLRQLPLDHDIVLSLKDEVKNKYNAHFMVYEDHRWVLLG 562
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r L ++  W+
  Brast10G198000.1.p 563 WKGRVLCALATWT 575
                         ************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.014176555IPR005202Transcription factor GRAS
PfamPF035141.2E-95203575IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MAATREELSG VVEPAPGPGS QQPQNDMSLA YISHMLMEDD IVDTSPDRYL GHPELLQAEK  60
PFAQILSAAN TTSAPSALAS TLLPRRDNNN STLFPGENKA SMLLSRDNVM MDGRGHKKRF  120
DMDDKTAPGR GRGRGRSRTD SEQEDTAVKM LDRLILNGYD RYPGEMQEVL ITLDKEKKTS  180
EKSIRRRRRG GTRQTQTVVT DLDTLLIRCA EAISRNDRRN ASEVLERIKW HSSPRGDARQ  240
RLAHYFAQGL EARLAGTGSE LYCSLIGKHT STLELVQAYH LQMATCCFVN VASLFSNYTI  300
YNAVAGRRKL HIVHYGVITG YKWPELIQRL AGREGGPPEV RITAINNPEP GFRPAELIKE  360
AGHRLSACAS KFGVPFKFNA VAAKLESVQA EDLHIDPDEV LVVHSLFQFR TMLDDSLTGN  420
KVNPRDMVLN TIRKMKPSVF VHAVVNGSYS AAVFMTRFRQ ALYYFTALFD MMDTAIPRGN  480
DKRMLVERDS FAWSAINMIA CEGTDRVERP QNYREWQAQN LRAGLRQLPL DHDIVLSLKD  540
EVKNKYNAHF MVYEDHRWVL LGWKGRVLCA LATWTVDDTS DSEVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-402065748374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575622.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3EH530.0A0A0Q3EH53_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-123SCARECROW-like 14