PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G197900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 637aa    MW: 71826.2 Da    PI: 6.865
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G197900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.41.9e-1052546252373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAea+ss+d + a++lL+r++  +sp+gd  qRla+yf+++L+arl++++s+ly+++  ++t     +e ++a++l++ ++ ++k
  Brast10G197900.1.p 254 ETLLIRCAEAISSNDRRSASELLERIKRYSSPTGDGRQRLAHYFAKGLEARLSGTGSQLYSSCMGRRTC---AVELIKAYHLYNATCCFVK 341
                         789*********************************************************999999888...9****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ l  N +I++aveg +++Hi+ ++i+ GlQWp L++ La+R++gpp+lRiTg++ p++g   +e++ etg+rL+++A+e+gvpf+f++ 
  Brast10G197900.1.p 342 MTLLFSNMTIYKAVEGRRKLHIVQYGINTGLQWPELIRWLANREGGPPELRITGINMPQPGfnLAEQIDETGHRLSNYASEFGVPFKFHA- 431
                         ************************************************************99999*************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +  +le+++ e+L+++p+E+l+Vn+ +q   l+des++ ++  +rd vL+ ++ ++P ++v++  + +++++ F++rf + l+++++lfd+
  Brast10G197900.1.p 432 IIAQLEAVQAEDLHIDPDEVLIVNSLFQFRILMDESLTFDKvnPRDMVLNNIRMMKPSMFVHAITNGSYSAAVFMTRFRKVLSHFTSLFDM 522
                         6999*********************************9998889*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+ +p ++++r  vEr +++r+++n++acegaer+er +++++W++r ++aG++++pl+ +++  +k  +++ + + ++++e++ +l++g
  Brast10G197900.1.p 523 METIIPGNNDKRLQVERYFFARSAMNIIACEGAERVERPQNYREWQARNHRAGLRQLPLDPDIVLMVKDKVKNQYHKHFMINEDHRWLLQG 613
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L++vS W
  Brast10G197900.1.p 614 WKGRVLYAVSTW 625
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.305227606IPR005202Transcription factor GRAS
PfamPF035146.7E-103254625IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MAAIQEELLD VVESAPLPPS VVLDVDLPPM THGDSKRPQD DLSMAYISCM LMEDDIIDKF  60
SYQYPDHPKL LQAEQPFAQI LSADATTSSN VEESSASDVL ASALLPNKVK HPAFFSNGTG  120
AVESSSTLFP SESSTNMDML SSMAFFKGME EANMFLPRGN RMVGGRGRKN RFDMDGEIEG  180
CMGRSSKQIV LVHNYLDKEA TALKMLDQLV LNGDDTCPGE MQEVLINKEN VVAQKRIRRR  240
GRGSARHMVV TDLETLLIRC AEAISSNDRR SASELLERIK RYSSPTGDGR QRLAHYFAKG  300
LEARLSGTGS QLYSSCMGRR TCAVELIKAY HLYNATCCFV KMTLLFSNMT IYKAVEGRRK  360
LHIVQYGINT GLQWPELIRW LANREGGPPE LRITGINMPQ PGFNLAEQID ETGHRLSNYA  420
SEFGVPFKFH AIIAQLEAVQ AEDLHIDPDE VLIVNSLFQF RILMDESLTF DKVNPRDMVL  480
NNIRMMKPSM FVHAITNGSY SAAVFMTRFR KVLSHFTSLF DMMETIIPGN NDKRLQVERY  540
FFARSAMNII ACEGAERVER PQNYREWQAR NHRAGLRQLP LDPDIVLMVK DKVKNQYHKH  600
FMINEDHRWL LQGWKGRVLY AVSTWAADNA GGSELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-442576258374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575624.30.0PREDICTED: scarecrow-like protein 33
TrEMBLI1IJ290.0I1IJ29_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-131GRAS family protein