PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G197800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 638aa    MW: 72311.5 Da    PI: 6.395
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G197800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS323.93.3e-992556272374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cA+av+s++ + +++lL+++++ + p+gd+ qRla+yf+++L+arl++++s+ly+++  ++ts    +e ++a++l++ ++ ++k
  Brast10G197800.1.p 255 ETLLIRCAKAVDSNNWQSTSELLEQIKQYCLPTGDARQRLAHYFAKGLEARLTGTGSQLYHSIMGTHTS---NVELIKAYHLYNATCCFIK 342
                         789************************************************************999998...89***************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++ l  N++I++av+g +++Hi+ ++i+ GlQWp L++ La+R++gpp++RiTg++ p+++    ++++etg+rL+++A+++g++f+ ++ 
  Brast10G197800.1.p 343 MALLFSNNTIYNAVAGRRKLHIVHYGINSGLQWPELIRRLADREGGPPEVRITGINMPQPEflPVKQIKETGDRLRNYASKFGMSFKLHA- 432
                         ************************************************************99****************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++ + e+++ e+L+++p+E+l+Vn+++q  +l+des++ e   +rd vL+++ +++P+v++++  + +++++ F++rf +al++++a fd 
  Brast10G197800.1.p 433 ITANPEAVRAEDLHIDPDEVLIVNSIFQFRTLMDESLNFERvnPRDMVLNTISKMKPDVFIHAVCNGSYSGAYFMTRFRQALYHFAASFDV 523
                         6899*********************************9998889*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e++  r+++ r  +Er ++gr + n+++cega+r+er  ++++W++r ++aG++++pl+ +++   k  +++ + + ++++e++ +l++g
  Brast10G197800.1.p 524 METTTQRNNNMRLLLERDIFGRCAINMITCEGADRVERPHNYKEWQARNHRAGLRQLPLDPNIVLMLKDKVKNQYHKHFMINEDHRWLLQG 614
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r L ++S W+
  Brast10G197800.1.p 615 WKGRVLNALSTWT 627
                         ************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.768228607IPR005202Transcription factor GRAS
PfamPF035141.1E-96255627IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MFATPEELLG VVEPVPLPPS FPMIHVDSKQ TQDNLSMPYI SRMLMEDDII DKFFYQYPDH  60
PKIEQAEQPF AQILSNAATT SSDNEESMPP GMHASALMPS QDHNMDIQIS EFFSCKVLNP  120
AFFLGGTDRV EPDSTMFPSE SSISMDMLSS MAFFKGVEEA SMFLPSNNGM VDGRVTCMDG  180
EAVGMGRSSK QITVMVHTDS EDTLRLLDRL ILNGYDKYPG EMQEVLIDKE HKAAQKSFCR  240
RGRGSVAQTV VTDLETLLIR CAKAVDSNNW QSTSELLEQI KQYCLPTGDA RQRLAHYFAK  300
GLEARLTGTG SQLYHSIMGT HTSNVELIKA YHLYNATCCF IKMALLFSNN TIYNAVAGRR  360
KLHIVHYGIN SGLQWPELIR RLADREGGPP EVRITGINMP QPEFLPVKQI KETGDRLRNY  420
ASKFGMSFKL HAITANPEAV RAEDLHIDPD EVLIVNSIFQ FRTLMDESLN FERVNPRDMV  480
LNTISKMKPD VFIHAVCNGS YSGAYFMTRF RQALYHFAAS FDVMETTTQR NNNMRLLLER  540
DIFGRCAINM ITCEGADRVE RPHNYKEWQA RNHRAGLRQL PLDPNIVLML KDKVKNQYHK  600
HFMINEDHRW LLQGWKGRVL NALSTWTADN ASGSEET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-402586268374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH210.0A0A0Q3EH21_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-123GRAS family protein