PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G197600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 630aa    MW: 71724.8 Da    PI: 6.8587
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G197600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3451.2e-1052476182373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         + lL++cAeav+s+d + a++lL+r++ ++s++g++ qRla+yf++AL+arla+++ + y+ l  ++ts   ++e ++a++l+s ++ ++k
  Brast10G197600.1.p 247 EMLLIRCAEAVASNDRSSASELLERIKWHSSSRGNARQRLAHYFAQALEARLAGTGRQFYQPLIGTRTS---TVELIKAHHLYSATFCFVK 334
                         579*********************************************************999877777...8****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++l  N++I++av+g +++Hi+ ++i+ GlQWp L++ La+R++gpp++R+T +++p++g   +e++ee g+rL+++A+++gv+f+f++ 
  Brast10G197600.1.p 335 VAFLFSNKTIYNAVAGRRKLHIVHYGINTGLQWPDLIRWLADREGGPPEVRMTSIDRPQPGfrLSEQIEEAGHRLTNYASKFGVSFKFHA- 424
                         ************************************************************99999*************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++ + e+++ e+L+++p+E+l+Vn+ +q  +l+des++ +   +rd+vL+++++++P v+v++ ++ +++s+ F++rf +al+ ++a+fd 
  Brast10G197600.1.p 425 ITAEPEAVRAEDLHIDPDEVLVVNSLFQSRNLMDESLAFDRvsPRDKVLNTIRKIKPSVFVHCISNGSYGSAFFMTRFRHALHNFTAMFDV 515
                         68899*******************************9988777************************************************ PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+++pr++++r  +Er +++r+++n++aceg++r+er +++++W++r ++aG++++pl+ +++   k  +r+ + + ++++e++ +l++g
  Brast10G197600.1.p 516 METTIPRNNDKRLQLERDFFARSAMNMIACEGEDRVERPQNYREWQMRSHRAGLRQLPLDPDIVLMLKEEVRNQYHKHFMINEDHRWLLQG 606
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r+L+++S W
  Brast10G197600.1.p 607 WKGRALYALSTW 618
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.625220599IPR005202Transcription factor GRAS
PfamPF035144.3E-103247618IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MAVTQEELLG VIESAPLPWS VSLHLPPTTH GDSKQPQDDL SLAYISRMLM EDDIVDKFVY  60
QYPDQPKLLQ AEQHFAQILS TAATTSFDAQ ESSAPDALAC ALLPSKVQDP AFFWSGTVEL  120
SSTLFPLECS TVMNKMSHMA FFKGIEEGKM FLPRDNGMVD SRGCKNKFDM GGVTEPAMGR  180
SSKRIAVMVQ TDTEEDDELK KMLDRLILDG YDRYPGEMQD ILITLDKENI CRRRRRGARQ  240
MVVTDLEMLL IRCAEAVASN DRSSASELLE RIKWHSSSRG NARQRLAHYF AQALEARLAG  300
TGRQFYQPLI GTRTSTVELI KAHHLYSATF CFVKVAFLFS NKTIYNAVAG RRKLHIVHYG  360
INTGLQWPDL IRWLADREGG PPEVRMTSID RPQPGFRLSE QIEEAGHRLT NYASKFGVSF  420
KFHAITAEPE AVRAEDLHID PDEVLVVNSL FQSRNLMDES LAFDRVSPRD KVLNTIRKIK  480
PSVFVHCISN GSYGSAFFMT RFRHALHNFT AMFDVMETTI PRNNDKRLQL ERDFFARSAM  540
NMIACEGEDR VERPQNYREW QMRSHRAGLR QLPLDPDIVL MLKEEVRNQY HKHFMINEDH  600
RWLLQGWKGR ALYALSTWAA DDAGGSELT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-382506188374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573186.10.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3H1290.0A0A0Q3H129_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-126GRAS family protein