PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G197500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 638aa    MW: 72472.7 Da    PI: 6.3791
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G197500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3273.7e-1002556262373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cAeav+s++l+ a+++L++++  +sp+gd+ qRla+yf+++L+arla+++s+ y+ l  ++ts   ++e ++a++l++ ++ +lk
  Brast10G197500.1.p 255 DTLLIRCAEAVASNNLHSASEVLEQIKRYSSPTGDARQRLAHYFAQGLEARLADTGSQFYHLLIGTRTS---TVELVKAYHLYNATFSFLK 342
                         679**********************************************************99888887...899**************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++l  N++I++av++ +++Hi+ ++i+ GlQWp L++ La+R++gpp++R+T ++ p++g   +e++ee g+rL+++A+++gv+++f++ 
  Brast10G197500.1.p 343 VAFLFSNKTIYQAVAERKKLHIVHYGINIGLQWPDLIRWLADREDGPPEVRMTSINMPQPGfhPSEQIEEAGHRLSNYASKFGVSIKFHA- 432
                         ************************************************************999***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          + + e+++ e+L+++++E+l+V++ +q  +l+des++ +s  +rd vL+++++++P v+v+   + +++++ F++rf +al++++alfd+
  Brast10G197500.1.p 433 FTAKPEAVRAEDLHIDSDEVLIVSSLFQFRTLMDESLTFDSvsPRDMVLNTIRKMKPSVFVHGVANGSYSAAFFMTRFRQALYFFTALFDM 523
                         58899********************************999888************************************************ PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         +e+ +pr++++r  vEr +++r++ n++acega+r+er +++++W+ r +++G++++pl+ +++   k  +++ + +  +++e++++l++g
  Brast10G197500.1.p 524 METMVPRDNKQRLQVERDFFARSAINMIACEGADRVERPQNYKEWQIRNHRVGLRQLPLDPDIVLMLKDEVKNQNHKHIMINEDRQWLLQG 614
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++S+W
  Brast10G197500.1.p 615 WKGRVLYALSSW 626
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.48228607IPR005202Transcription factor GRAS
PfamPF035141.3E-97255626IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MVATEEELLG VTESVPLPPS IFLDLPPTTH GDSKQPQDDL SLEYISRMLM EDDIVDKFTY  60
QYPDHLKLLQ AEQPFAQILS AAATTSFDAR ESSAPDVLAS ALLPRKVQDS AFFSDGTCTM  120
EPRSTVFPIE SSTSMNKMSS MAFFKGMEEA KMFLPSDIVM VNNRGCKNKF DMDGEKEPAM  180
GRSSKQIAAL VHTDSEEEDE IKKRLDRLIL KGYDRYPGEM QEVLITLNKE NKAAQKSIRM  240
RGRRGAMQVV VTDLDTLLIR CAEAVASNNL HSASEVLEQI KRYSSPTGDA RQRLAHYFAQ  300
GLEARLADTG SQFYHLLIGT RTSTVELVKA YHLYNATFSF LKVAFLFSNK TIYQAVAERK  360
KLHIVHYGIN IGLQWPDLIR WLADREDGPP EVRMTSINMP QPGFHPSEQI EEAGHRLSNY  420
ASKFGVSIKF HAFTAKPEAV RAEDLHIDSD EVLIVSSLFQ FRTLMDESLT FDSVSPRDMV  480
LNTIRKMKPS VFVHGVANGS YSAAFFMTRF RQALYFFTAL FDMMETMVPR DNKQRLQVER  540
DFFARSAINM IACEGADRVE RPQNYKEWQI RNHRVGLRQL PLDPDIVLML KDEVKNQNHK  600
HIMINEDRQW LLQGWKGRVL YALSSWVADD ANNSQVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-412586268374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238972.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3HFE30.0A0A0Q3HFE3_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-125GRAS family protein