PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G177900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 394aa    MW: 43976.7 Da    PI: 6.7433
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G177900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.23.3e-215194245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        + en+s r+vt+skRr gilKKA+ELS+LCd++  +++fs++g+
  Brast10G177900.1.p 51 KLENSSGRHVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGR 94
                        679**************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.1794294IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-2842101IPR002100Transcription factor, MADS-box
CDDcd001201.96E-234395No hitNo description
SuperFamilySSF554552.49E-2443136IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-164464IPR002100Transcription factor, MADS-box
PfamPF003192.1E-185295IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-166479IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-1679100IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MLDSNAVPST IGTTLVRRPD CCIVQPAISE EDCVSLARRR IMGRVKLKIK KLENSSGRHV  60
TYSKRRSGIL KKAKELSILC DIDLILLMFS PSGRPTICVG DRSNLEEVIA KYAQQTPQER  120
AKRKLESLEA LKKTFKKLDH DVNIQDFLGS GLIVSIILQE LASHLGALQC QMGDVQKRLS  180
YWSEPEKVEN IDHIRAMEQS LKESLNRIGI HKENFAKQHL MGLQCAAAQF QNEMQLPLGI  240
PGDPNSSSWF HSSSNSDRQQ TMMLPDEAGL QSYPGYFGMS KQSTETGGEQ HQQAAVAAQH  300
QPEFSQQAAD CLTSLHLTGQ FPYQSSFDHT SLLNDRLFRP DMELHVDNAS AAMDFGGHYD  360
QLPRPGDEAS FQNWASATCG VTMYDHQQQP TSAQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast10G177900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693370.0KF469337.1 Brachypodium distachyon MADS-box transcription factor 43 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288313.10.0MADS-box transcription factor 7-like
TrEMBLI1IJN20.0I1IJN2_BRADI; MADS-box transcription factor 43
STRINGBRADI4G11097.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-66AGAMOUS-like 65