PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G046400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 748aa    MW: 82613.9 Da    PI: 5.5386
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G046400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS345.31e-1053677381373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+av+++d + a++lL++++ +a  dgd +qRla++f+e+L+arla+++  + ++l +++ s    ++ l+a++l+  +  + 
  Brast10G046400.1.p 367 LRTLLIHCAQAVATDDRRSATELLKQIKLHARHDGDGTQRLAHCFAEGLQARLAGTGGLVHQSLMATRIS---AVDMLKAYQLYMAAICFK 454
                         6789***************************************************888888777777776...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k++++  N +I++a  g++++HiiD++i++G+QWp++l+ +++R++gpp++RiTg++ p++g   + ++eetg+rL+k+A+e++vpf++++
  Brast10G046400.1.p 455 KVCFIFSNFTIYNASLGKKKIHIIDYGIQYGFQWPCFLRRISEREGGPPEVRITGIDLPQPGfrPAARIEETGRRLSKYASEFKVPFKYHA 545
                         *************************************************************9*9*************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         ++++++e+l+ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf e l yysalfd l
  Brast10G046400.1.p 546 MAVTNMESLRKEDLNIDPEEVLIVNCLFQFKNLMDESVVIESPRDIVLNNIRKMQPHAFIHAIVNGSFSAPFFVTRFREVLFYYSALFDVL 636
                         *9***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++ pr++e+r+ +E+ ++gr++ nv+acega+r+er et+++W+ r ++aG+k++pl+ ++ ++++  +++++ + + ++ ++++l+ gW
  Brast10G046400.1.p 637 DTTTPRDNEQRMLIEQNIFGRAALNVIACEGADRVERPETYKQWQVRNQRAGLKQLPLNPDIIETVRDKVKNCYHKDFVIDVDHNWLLEGW 727
                         **************************************************************************889************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r L+++S+W
  Brast10G046400.1.p 728 KGRILYAISSW 738
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.596341719IPR005202Transcription factor GRAS
PfamPF035143.5E-103367738IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MGSSPYLPSA MDSPGSDDPS LYLYLSDLIP GSPPASPSAY LDLPPTPHHE QPQPQQQQQR  60
SSGYDDRSGG GGGGGGDKSS STPEDLVLPF ISRMLMEEDI DDKFFYDYPD NPALLQAQQP  120
FLDILSDPSS NTTSSDSGNN NNPCSPSDAS FSPAGPLPPT PAAVDSYDHH QPFQYDLDPA  180
AFFSAGANSD LMSSAFLKGM EEANKFLPSQ GNLVIDLEAS SGQFLKGVEE GNKFLPREDK  240
LVVGFNGRAA PVSAPTAVAS VKKEEPVDSV SANSRGGSRG RKNPYHDDEL EQEVGRNSKQ  300
SALQGDDISA RELFDRVLMP SPEMCVEQMQ NLRIAMQEAV AKNDTGGGKA GNGKGRGRRG  360
GSDVVDLRTL LIHCAQAVAT DDRRSATELL KQIKLHARHD GDGTQRLAHC FAEGLQARLA  420
GTGGLVHQSL MATRISAVDM LKAYQLYMAA ICFKKVCFIF SNFTIYNASL GKKKIHIIDY  480
GIQYGFQWPC FLRRISEREG GPPEVRITGI DLPQPGFRPA ARIEETGRRL SKYASEFKVP  540
FKYHAMAVTN MESLRKEDLN IDPEEVLIVN CLFQFKNLMD ESVVIESPRD IVLNNIRKMQ  600
PHAFIHAIVN GSFSAPFFVT RFREVLFYYS ALFDVLDTTT PRDNEQRMLI EQNIFGRAAL  660
NVIACEGADR VERPETYKQW QVRNQRAGLK QLPLNPDIIE TVRDKVKNCY HKDFVIDVDH  720
NWLLEGWKGR ILYAISSWVA NDASSHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-423717388374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0Q3EEW90.0A0A0Q3EEW9_BRADI; Uncharacterized protein
STRINGBRADI4G03867.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-160GRAS family protein