PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G024900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 308aa    MW: 33147.9 Da    PI: 4.9108
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G024900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.15e-15111164457
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          kr +r+ +NRe+ArrsR+RK+a +   e  v +L aeN +L k+l  ++++++
  Brast10G024900.1.p 111 AKRVKRMLSNRESARRSRKRKQAHQTDIESQVTQLRAENASLLKRLTDMTQKYK 164
                         79*************************************999966555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-12107164No hitNo description
SMARTSM003381.3E-15108172IPR004827Basic-leucine zipper domain
PfamPF001705.3E-13110164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.07110165IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12112163No hitNo description
CDDcd147024.85E-18113163No hitNo description
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
PfamPF124981.5E-25179287IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEFSGDEVVE VNCARGGGGG GDPGVYAAVL KRKLDLYCAA VAKTMEAKPQ ESALGAMQLV  60
SQASDTSQLV SQASFDGDGT VVQGKPANSC TSKEQSDVDG DLEENTDPAN AKRVKRMLSN  120
RESARRSRKR KQAHQTDIES QVTQLRAENA SLLKRLTDMT QKYKEATLGN RNLTVDMETM  180
RRKVNIAEEA VRRVTGTSLL FSITPDMPGS SVPFSSCISD AASADAAPTE ESMSHLLQGF  240
LEDDQIKPDL PQAETPVVPS GEEMASRPAT LRRVASLESL QQRFHGDSIH PETASTFSDH  300
EFPANAL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130RRSRKRK
2124131RRSRKRKQ
3126131SRKRKQ
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast10G024900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2515891e-169AK251589.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf118p04, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577778.10.0light-inducible protein CPRF2
SwissprotQ990902e-39CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLI1IGR50.0I1IGR5_BRADI; Uncharacterized protein
STRINGBRADI4G02570.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-33bZIP family protein
Publications ? help Back to Top
  1. Weisshaar B,Armstrong GA,Block A,da Costa e Silva O,Hahlbrock K
    Light-inducible and constitutively expressed DNA-binding proteins recognizing a plant promoter element with functional relevance in light responsiveness.
    EMBO J., 1991. 10(7): p. 1777-86
    [PMID:2050115]