PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G234700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 244aa    MW: 26094.7 Da    PI: 10.2199
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G234700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.33.5e-2087146357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++++eq+++Le+l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Brast09G234700.1.p  87 TRWNPSAEQIKVLEALYRGgMRTPNAAQIERITEELgrhgRIEGKNVFYWFQNHKARERQ 146
                         7*****************99**************************************97 PP

2Wus_type_Homeobox114.84.2e-3786148365
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          tRW+P++eQik+Le+ly+ G+rtPn+++i+rit+eL ++G+ie+kNVfyWFQN+kaRerqkq
  Brast09G234700.1.p  86 MTRWNPSAEQIKVLEALYRGGMRTPNAAQIERITEELGRHGRIEGKNVFYWFQNHKARERQKQ 148
                         58***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.28482147IPR001356Homeobox domain
SMARTSM003891.7E-784151IPR001356Homeobox domain
CDDcd000869.13E-687148No hitNo description
PfamPF000469.2E-1887146IPR001356Homeobox domain
SuperFamilySSF466896.42E-1387152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-888146IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MRLQHLHVGA YLENKKAARS SSSSSSSTSP APSTLSPPFP FAFQCLRPLA PKISLPEPRT  60
KAPDFGRVRT AAKLLACTVQ VAAGGMTRWN PSAEQIKVLE ALYRGGMRTP NAAQIERITE  120
ELGRHGRIEG KNVFYWFQNH KARERQKQKR AALLTLATAG AGLDDSSNSP PTPPETTTTK  180
DAAKKMEAMA CGDEATTSCK RRCKAWGDGG HGGAAATEAV AGDCRAVDDV TLELFPLRPH  240
GKA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8361596e-81JF836159.1 Oryza sativa Japonica Group WUSCHEL-like homeobox protein (WOX4) mRNA, complete cds.
GenBankAJ5561816e-81AJ556181.1 Oryza sativa Japonica Group partial mRNA for homeobox protein HB3 (hb3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227318.21e-115PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ25AM21e-90WOX4_ORYSI; WUSCHEL-related homeobox 4
SwissprotQ7XTV31e-90WOX4_ORYSJ; WUSCHEL-related homeobox 4
TrEMBLI1J2M21e-115I1J2M2_BRADI; Uncharacterized protein
STRINGBRADI5G24080.11e-115(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP126923035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.15e-36WUSCHEL related homeobox 4