PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G192400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LFY
Protein Properties Length: 384aa    MW: 41935.7 Da    PI: 9.4403
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G192400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY525.12.9e-16013731386
             FLO_LFY   1 mdpea..fsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddl 89 
                         mdp++  ++a+ f+wd  + a app+  ++   v++       a a  + releel+++yGvr +tva+i+elGft+stL+ m+++eldd+
  Brast09G192400.1.p   1 MDPNDayLAAHPFRWDLGPPAPAPPTP-APAPPVPQ-------APAPPAPRELEELVSGYGVRASTVARISELGFTASTLLVMTERELDDM 83 
                         777664568889****65433333322.22222222.......23445579**************************************** PP

             FLO_LFY  90 mkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekk 180
                         +++l+ +fr+dll+Ger+G++aa+raer rl++      r     +++ +++d +sqe+ls+e++      ++sgg+g+ e +++++++++
  Brast09G192400.1.p  84 TAALAGLFRWDLLIGERFGLRAALRAERSRLMSPP--GCRL----HHSLSTVDGASQEVLSNERD-----GVASGGMGEDEGKVAGKKQRN 163
                         ********************************966..5555....3566789**********977.....567777776666666666555 PP

             FLO_LFY 181 seeekkkaskkkqkrkkkkelkse.....ededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqv 266
                          ++ +kka+  ++k+ + ++l+ +     ed   ++e+ e++ g++++g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqv
  Brast09G192400.1.p 164 GSAGRKKARM-RKKKVEGERLRLDvqeeeEDGGGRSESGESSAGGAQGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRLFLLQV 253
                         5555555533.333333333333332211222223344445555778889***************************************** PP

             FLO_LFY 267 qkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdida 357
                         q++ak +G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde  s+alrra+k+rgenvGawrqacy+plv+i+ar+g+dida
  Brast09G192400.1.p 254 QSMAKLHGQKSPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEAGSDALRRAYKARGENVGAWRQACYAPLVDISARHGFDIDA 344
                         ******************************************************************************************* PP

             FLO_LFY 358 vfnahprLsiWYvPtkLrqLChlerskas 386
                         vf+ahprL++WYvPt+Lr LCh++rs+a 
  Brast09G192400.1.p 345 VFAAHPRLAVWYVPTRLRLLCHQARSSAH 373
                         *************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.4E-1831372IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDPNDAYLAA HPFRWDLGPP APAPPTPAPA PPVPQAPAPP APRELEELVS GYGVRASTVA  60
RISELGFTAS TLLVMTEREL DDMTAALAGL FRWDLLIGER FGLRAALRAE RSRLMSPPGC  120
RLHHSLSTVD GASQEVLSNE RDGVASGGMG EDEGKVAGKK QRNGSAGRKK ARMRKKKVEG  180
ERLRLDVQEE EEDGGGRSES GESSAGGAQG GGERQREHPF VVTEPGEVAR AKKNGLDYLF  240
HLYEQCRLFL LQVQSMAKLH GQKSPTKVTN QVFRYAKKVG ASYINKPKMR HYVHCYALHC  300
LDEAGSDALR RAYKARGENV GAWRQACYAP LVDISARHGF DIDAVFAAHP RLAVWYVPTR  360
LRLLCHQARS SAHAHALPPP PMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A2e-962113712162PROTEIN LEAFY
2vy2_A2e-962113712162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast09G192400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2318880.0AB231888.1 Triticum aestivum WFLa mRNA for FLORICAULA/LEAFY-like protein, complete cds.
GenBankAB2318900.0AB231890.1 Triticum aestivum WFLd mRNA for FLORICAULA/LFAFY-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580435.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLI1J1B60.0I1J1B6_BRADI; Uncharacterized protein
STRINGBRADI5G20340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.14e-91floral meristem identity control protein LEAFY (LFY)