PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G181200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 634aa    MW: 66793.5 Da    PI: 7.5826
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G181200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.74.9e-972666332374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL e+A a+++g+le a a La+l+  a+p+gd+ +Rl a+++ AL++r+a + s ++k +     ++   +e+ +  +l++++sP+++
  Brast09G181200.1.p 266 RQLLSEAAVAMADGNLETAAAHLATLKRAANPRGDAEHRLLAMMVAALSSRIAPTASATSKHM-----ADLCGTEHRTGSQLLHDISPCFR 351
                         689***************************************************444444433.....3333667778889********** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefn 179
                         f+  +aN aIleav+ ++++H +Dfdis + Q +aL+q La+R+ +  sl++T+v +p s      + +l ++g rL+k+Ae+ g++  f+
  Brast09G181200.1.p 352 FALHAANIAILEAVADHRAIHLVDFDISVP-QHVALIQCLADRRVPGTSLKVTAVTDPISPftesLTATLPAVGARLKKLAERAGIEYGFQ 441
                         ****************************98.99************************98777777788999******************** PP

                GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         + v+ r ++++ ++L ++pgEalaVnl+++l +++desvs +++rde+L+ v++l P+vv++veqe++ n++++++rf++a+ +y a+++s
  Brast09G181200.1.p 442 I-VSCRAAEIDSSKLGCEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRGLGPRVVTLVEQELNSNTAPLATRFTDACAHYGAILES 531
                         9.7899************************************************************************************* PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a+++r+s +r+  E++ +++++ n+v  ega+r er+e ++kWr+r+++aGF+pv+l + +a+q+k+ + + +  g+ v+ e+g l lg
  Brast09G181200.1.p 532 LDATVARDSADRARAEEA-VANKAANAVGREGADRLERCEVFGKWRARFGMAGFRPVALATGIADQVKARVGTSQ-PGFAVKPENGVLRLG 620
                         ******************.9999*************************************************999.9************** PP

                GRAS 362 WkdrpLvsvSaWr 374
                         W++r ++++SaWr
  Brast09G181200.1.p 621 WMGRVITVASAWR 633
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.66239614IPR005202Transcription factor GRAS
PfamPF035141.7E-94266633IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MEPGGPWRDP RQGYLYGVGS AMQMPLQQQQ RSDTAAVGGV LKRSLGEIER WQHQRQVAMQ  60
QELYMRAVRQ RTAAASAAAI SPLSSADIAA VLGRGPSQQL VLSGSSLGGN LASPSSTLSS  120
LTTASRAAIP LIQPQLHRQV PFVPSSEQAH ALGVTRAPAP SATGSELSIL QELEKQLLFD  180
DDEAEPAMSA TGSAVTSSEW EETMIQQLNS ITAAPSPPFP AVAAPKNNNC YNNNNAGMTR  240
SPSNSSTSTA SSSASCSPPT SATTSRQLLS EAAVAMADGN LETAAAHLAT LKRAANPRGD  300
AEHRLLAMMV AALSSRIAPT ASATSKHMAD LCGTEHRTGS QLLHDISPCF RFALHAANIA  360
ILEAVADHRA IHLVDFDISV PQHVALIQCL ADRRVPGTSL KVTAVTDPIS PFTESLTATL  420
PAVGARLKKL AERAGIEYGF QIVSCRAAEI DSSKLGCEPG EALAVNLAFA LSHVPDESVS  480
PANPRDELLR RVRGLGPRVV TLVEQELNSN TAPLATRFTD ACAHYGAILE SLDATVARDS  540
ADRARAEEAV ANKAANAVGR EGADRLERCE VFGKWRARFG MAGFRPVALA TGIADQVKAR  600
VGTSQPGFAV KPENGVLRLG WMGRVITVAS AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-412616331375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLI1J0W50.0I1J0W5_BRADI; Uncharacterized protein
STRINGBRADI5G19190.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-78SCARECROW-like 8