PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G165200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 357aa    MW: 37686.5 Da    PI: 10.1688
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G165200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-40115191177
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         +CqvegC+  l+ akeyhrrhkvCe+h+kap v+v+g eqrfCqqCsrfh++sefD++krsCrrrLa+hnerrrk++
  Brast09G165200.1.p 115 RCQVEGCHLALAGAKEYHRRHKVCEAHAKAPRVVVHGAEQRFCQQCSRFHAMSEFDDAKRSCRRRLAGHNERRRKSN 191
                         6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-34110177IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.436113190IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-38114193IPR004333Transcription factor, SBP-box
PfamPF031104.0E-32116189IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEGDSGAGPR ATAPWDLGMQ WTPPPPATSA YPQRFMPPPP PGGASAQRQQ QMQQELTSLK  60
LGKRPCYLPS WRDGQVAQLG AGHVDVNGGG RAVAAPEGKR KEKAGAATAT AAVPRCQVEG  120
CHLALAGAKE YHRRHKVCEA HAKAPRVVVH GAEQRFCQQC SRFHAMSEFD DAKRSCRRRL  180
AGHNERRRKS NASEAMARGS AHTHGVPSLV HGFAPYGALP TASQAGALSL LSSARATPWQ  240
LIPTAPDAFP ARSSSAALDE LIAENRAALL ACQFFPGRPA AAPAGSMPGG WRARQQQQQA  300
PAGHVTLDLM QAPTQAALLR PMPMPDRASS RPAEDHDDEA GRGSGAWAPL QGAHVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31107189284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast09G165200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9646561e-105EU964656.1 Zea mays clone 280651 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581504.20.0squamosa promoter-binding-like protein 7
SwissprotQ01JD11e-106SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLA0A0Q3P5600.0A0A0Q3P560_BRADI; Uncharacterized protein
STRINGOMERI04G16650.11e-105(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-36squamosa promoter binding protein-like 3