PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G130300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 370aa    MW: 39952.5 Da    PI: 6.1917
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G130300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.68.6e-11167225563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L+ +l++l+     l+se+
  Brast09G130300.1.p 167 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLAAQLSMLQIDTRGLTSEN 225
                         9*********************************************9987777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-16163227IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.45165228IPR004827Basic-leucine zipper domain
PfamPF001703.1E-9167221IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11167218No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-10167219No hitNo description
CDDcd147034.46E-21168215No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDVPSASAST SAAGSASRDV AAMPDTPPRR AGGHRRAQSE ILLGATALPD DLTFDADLGV  60
VGEVSGGGGD NYDDEDEYEE DEEGSGGGGS RMFEMFLESG GGLAEQLEPT PYPPPLPARP  120
RHQHSMSMDG STSLAAASSA MAGRAGADAK KAISDAKLAE LSLVDPKRAK RILANRQSAA  180
RSKERKMRYI AELERKVQTL QTEATTLAAQ LSMLQIDTRG LTSENGDLKL RLQTIEQQVR  240
MQDALNDRLR DEVQQLKIAT GQVNASSGKM GNFSLSSYGT NPQSYQRSHI QSLLAAQQLQ  300
QLQIHHSQQQ QHQMQLQDQQ HIATVQRQRQ QQLLKEAMPF PGDLKMKGIA MTSHVQNAAA  360
FDAHARSEP*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast09G130300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668881e-166AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353704.11e-152uncharacterized protein LOC100382174
SwissprotQ040881e-83POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU91e-151C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P011e-152(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.52e-46bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]