PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G106700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 92aa    MW: 10214.8 Da    PI: 10.5218
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G106700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF916.1e-291059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyey+s
  Brast09G106700.1.p 10 RIDNSTSRQVTFSKRRNGIFKKAKELGILCDAEVGLVIFSSTGRLYEYAS 59
                        8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.539161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-38160IPR002100Transcription factor, MADS-box
CDDcd002654.41E-43277No hitNo description
SuperFamilySSF554553.14E-33283IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELGILCD AEVGLVIFSS TGRLYEYASS  60
SMKSVIDRYG RAKEEQQLVA NPNSELKVCL T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-22183183MEF2C
5f28_B6e-22183183MEF2C
5f28_C6e-22183183MEF2C
5f28_D6e-22183183MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast09G106700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693311e-143KF469331.1 Brachypodium distachyon MADS-box transcription factor 37 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020189046.19e-57MADS-box transcription factor 27-like isoform X1
RefseqXP_020189047.11e-57MADS-box transcription factor 27-like isoform X2
SwissprotQ6EP496e-53MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A453C5692e-58A0A453C569_AEGTS; Uncharacterized protein
STRINGBRADI5G12440.17e-58(Brachypodium distachyon)
STRINGTRIUR3_19891-P14e-57(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.13e-46AGAMOUS-like 21
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]