PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G105300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 637aa    MW: 72478.6 Da    PI: 7.9709
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G105300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.76.8e-1022546252373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAe v+s+d   a+++L++++  +sp gd  qRla+yf+++L+arla+++s+ y++l+ ++ts   + + ++a++l+s ++ ++k
  Brast09G105300.1.p 254 ETLLIRCAESVASNDRWSASEVLEKIKRYSSPMGDGRQRLAHYFAQGLEARLAGTGSQFYHSLTRTRTS---TMKLVQAYHLYSATFCFFK 341
                         789**********************************************************99888888...7888899************ PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++l  N++I++av+g +++Hi+ ++i+ G+QWp L+q La+R++gpp++R+T +++p++g  ++e++ee g+rL+++A+++gv+++f++ 
  Brast09G105300.1.p 342 VAFLFSNKTIYKAVAGRKKLHIVHYGINIGVQWPELIQWLADREGGPPEVRMTSISRPQPGfrQSEQIEEAGHRLSNYASKFGVSIKFHA- 431
                         ******************************************************************************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++ + e+++ e++ ++p+E+l+Vn+ +q ++l+des++++   +rd vL+++k+++P v+v++  + +++++ F++rf +al+ ++++fd 
  Brast09G105300.1.p 432 ITAQPEAVRAEDIYIDPDEVLVVNSLFQFKTLMDESLTMDRvsPRDMVLSTIKKMKPSVFVHAITNGSYSAAFFMTRFRHALYNFTSFFDV 522
                         6889*********************************999888************************************************ PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         le+++pr+++ r  +Er +++r+++n++acega+r+er +++++W+ + ++aG++++pl+ +++   k  +++ + + ++++e++ +l++g
  Brast09G105300.1.p 523 LETTIPRNNDRRLQMERDFFARSVMNMIACEGADRVERPQNYREWQTQNHRAGLRQLPLDPDIVLMLKNKVKNEYHKHFMINEDHRWLLQG 613
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L+++S W
  Brast09G105300.1.p 614 WKGRVLYALSTW 625
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.27227606IPR005202Transcription factor GRAS
PfamPF035142.3E-99254625IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MAATQEELLG VVESAPLPLS VFLDLPPLTH SYSKQPQDDC SLEYVSRMLM EDDIVDKFTY  60
QYTDHPKLRQ IEQPFAQILS AADTTSFDAD ESSAPDALAS VLLPSKVQDP AFFSNGTLTV  120
EPRNTVFPME SITRMNKMPR TALFKGMEGG KMLLPRDFVT VDSRGCKNKF DVDGVTEAGM  180
GRSSKQIAVV VHTDSEEDEL KKRLDRLILN GYDRYPDEMK EVLITPDKEN KVAQKSSRMR  240
GRRGATQTVL TDLETLLIRC AESVASNDRW SASEVLEKIK RYSSPMGDGR QRLAHYFAQG  300
LEARLAGTGS QFYHSLTRTR TSTMKLVQAY HLYSATFCFF KVAFLFSNKT IYKAVAGRKK  360
LHIVHYGINI GVQWPELIQW LADREGGPPE VRMTSISRPQ PGFRQSEQIE EAGHRLSNYA  420
SKFGVSIKFH AITAQPEAVR AEDIYIDPDE VLVVNSLFQF KTLMDESLTM DRVSPRDMVL  480
STIKKMKPSV FVHAITNGSY SAAFFMTRFR HALYNFTSFF DVLETTIPRN NDRRLQMERD  540
FFARSVMNMI ACEGADRVER PQNYREWQTQ NHRAGLRQLP LDPDIVLMLK NKVKNEYHKH  600
FMINEDHRWL LQGWKGRVLY ALSTWVADDA SSSNVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-422576258374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581312.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH360.0A0A0Q3EH36_BRADI; Uncharacterized protein
TrEMBLA0A0Q3H1290.0A0A0Q3H129_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-130SCARECROW-like 14