PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G093200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23223.8 Da    PI: 7.57
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G093200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.22.5e-241058250
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        rien   rqvtf+kRr g+lKKA+ELSvLC+a++ vi++s++gk+ye +
  Brast09G093200.1.p 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCEADIGVIVISPHGKIYELA 58
                        8*********************************************965 PP

2K-box55.91.9e-1977173499
               K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                         ++g+s +++k +  qqe+  L++ei+ Lq+ +R + Ge d++ ++l eLq Le++Le  + ++ s+K++++ ++ie l++ke  l+ +n +
  Brast09G093200.1.p  77 AQGESSNQNKPQVIQQEVLLLRQEIDLLQKGLRYMYGEkDINHMNLDELQALESNLEIWVHNVLSTKMQIISREIEMLKNKEGILKAANDM 167
                         6788889999***************************868*************************************************** PP

               K-box  94 Lrkkle 99 
                         L++++ 
  Brast09G093200.1.p 168 LQERII 173
                         **9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.4E-26174IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.273161IPR002100Transcription factor, MADS-box
SMARTSM004327.1E-33160IPR002100Transcription factor, MADS-box
CDDcd002654.91E-34274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-221056IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-243859IPR002100Transcription factor, MADS-box
PfamPF014865.7E-2381172IPR002487Transcription factor, K-box
PROSITE profilePS5129712.92987179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCE ADIGVIVISP HGKIYELATN  60
GNMGSLIERY KGSNTEAQGE SSNQNKPQVI QQEVLLLRQE IDLLQKGLRY MYGEKDINHM  120
NLDELQALES NLEIWVHNVL STKMQIISRE IEMLKNKEGI LKAANDMLQE RIIEQSGILG  180
TSSDMLIPQF PFQRNTESDY YF*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast09G093200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693300.0KF469330.1 Brachypodium distachyon MADS-box transcription factor 36 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288322.11e-144MADS-box transcription factor 26-like
SwissprotA2YQK97e-77MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G87e-77MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLI1IY591e-142I1IY59_BRADI; MADS-box transcription factor 36
STRINGBRADI5G11270.11e-143(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.18e-56AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]