PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G083700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 176aa    MW: 19790.6 Da    PI: 9.9342
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G083700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-174495657
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        ++ ++q+ +Le+lF++++ p+++  ++L+ klg+  +qVk+WFqNrR  +kk
  Brast09G083700.1.p 44 RHHRDQVAQLEALFQQCPRPDEQVQQDLSVKLGMGANQVKFWFQNRRSAKKK 95
                        56789******************************************88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-162799IPR009057Homeodomain-like
SuperFamilySSF466895.13E-162898IPR009057Homeodomain-like
PROSITE profilePS5007114.3013696IPR001356Homeobox domain
SMARTSM003892.5E-1439100IPR001356Homeobox domain
CDDcd000866.34E-124090No hitNo description
PfamPF000466.7E-154595IPR001356Homeobox domain
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MDGLPFEPNT AVGNTDAADA VAAVKDNNDG ATDSQRTTTK RFKRHHRDQV AQLEALFQQC  60
PRPDEQVQQD LSVKLGMGAN QVKFWFQNRR SAKKKKKKQE EVKLLREENW MLHVENQAIK  120
TALCNKTCLK CRVPMVHIGD SPEKRRLLAE NAKLKNDLLH ANAFLNMVSG GSEGAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18894RRSAKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast09G083700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024311210.11e-103homeobox-leucine zipper protein ROC5
TrEMBLA0A2K2CGE81e-102A0A2K2CGE8_BRADI; Uncharacterized protein
STRINGBRADI5G10370.11e-101(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16772512
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.22e-22HD-ZIP family protein