PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G238200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 349aa    MW: 37094.2 Da    PI: 4.2247
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G238200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.91.7e-201664149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k+ie +  rqvtfskRrng++KKA+ELS LC++eva ++fs+ gk + +
  Brast08G238200.1.p 16 KPIEIEESRQVTFSKRRNGLFKKANELSELCGVEVASVVFSPAGKAFSF 64
                        67888999************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.988868IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-26878IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-30867IPR002100Transcription factor, MADS-box
CDDcd002658.91E-33975No hitNo description
PRINTSPR004041.8E-191030IPR002100Transcription factor, MADS-box
PfamPF003193.8E-241864IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-194566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAPRKPSMGR KKIEMKPIEI EESRQVTFSK RRNGLFKKAN ELSELCGVEV ASVVFSPAGK  60
AFSFGRPSVD AILNRLLADN AVPAPPVVPA VGGGGEGSSS SAPAAMAAEL QELNTTYAEL  120
RAMVEQEKLR KEQADEEMKR ELEAAGYATA AWLDADLAEL SEAELEEFEA ALMEMKDVVQ  180
LHADAMLREA VASAAAAIAA PAPAPAPSLP LPFSMPRRFP GSVFEGLFEV GGFSSGFANN  240
GGFGNSLIEV GGSSSGTNNG GTAMEDMQMQ MDDHMLQRQL DMMERLDLSD QIHPPPPVMG  300
QNPPPETMEL PPLPAQLPPP GMEFVPETMD LPPPDFGPNG GFFGPPPY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G238200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754099.17e-90agamous-like MADS-box protein AGL23
TrEMBLA0A0Q3KAM65e-92A0A0Q3KAM6_BRADI; Uncharacterized protein
STRINGBRADI1G20090.12e-53(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-22AGAMOUS-like 61