PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G238100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 310aa    MW: 32209.1 Da    PI: 4.4175
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G238100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.71.1e-1125591549
                        HHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF 15 kRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +Rr g++ KA+ELS LC++eva ++fs+ gk + +
  Brast08G238100.1.p 25 QRRLGLFRKASELSELCGVEVASVVFSPAGKAFSF 59
                        69****************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-17862IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-17873IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.213863IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-82540IPR002100Transcription factor, MADS-box
PfamPF003191.0E-132659IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-84061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MAPRKPSMGR KKIEMKPIEI DESRQRRLGL FRKASELSEL CGVEVASVVF SPAGKAFSFG  60
RPSVDAILNR LLADNAVPAP PVVPAVGGGG EGSSSSAPAA MAAELQELNT TYAELRAMVE  120
QEKLRNGQRA PRLFLVGGSS SGANNGGFGN SLFQVGGSSS GFANNGGFGN SLFEVGVSSS  180
GANNGGFHNS LFQVGGSSSG NNNGGFTGLF EVGGSSFRNN NGGTAMEDMQ MQMDDDMLQQ  240
QLDTMAQLDP SDQIPPPPPP PGMGFPETME LPPLPAQLPP PRMVFPETMD LPPPDFVGPD  300
GGFFGPPPY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G238100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754099.17e-55agamous-like MADS-box protein AGL23
TrEMBLA0A0Q3KAM61e-56A0A0Q3KAM6_BRADI; Uncharacterized protein
STRINGBRADI2G26320.11e-52(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-18AGAMOUS-like 61