PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G228400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 177aa    MW: 18232 Da    PI: 7.002
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G228400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13e-4323121199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C++ C+lapyfp ++p+kfa++h++FGasn++kll++lpee+r da+sslvyeA arardPvyGa+g i++lq+ql+ lk
  Brast08G228400.1.p  23 PCAACKILRRRCVERCILAPYFPPTDPHKFAAAHRVFGASNIIKLLQDLPEEHRADAVSSLVYEAGARARDPVYGAAGAIWQLQRQLDALK 113
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         a+la++++
  Brast08G228400.1.p 114 AQLAQAQA 121
                         ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.59522123IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4223120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MESSSGDTTA APPAAAAAVV LSPCAACKIL RRRCVERCIL APYFPPTDPH KFAAAHRVFG  60
ASNIIKLLQD LPEEHRADAV SSLVYEAGAR ARDPVYGAAG AIWQLQRQLD ALKAQLAQAQ  120
AHRAHLVAIL CEIAAGGPPV VQVDPALLCA GAGGGGGGPV LQASPMGWAD EPLIWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-382212110109LOB family transfactor Ramosa2.1
5ly0_B2e-382212110109LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G228400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960340.12e-71LOB domain-containing protein 1
SwissprotQ9LQR01e-54LBD1_ARATH; LOB domain-containing protein 1
TrEMBLK3ZCZ94e-70K3ZCZ9_SETIT; Uncharacterized protein
STRINGSi024430m6e-71(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-41LOB domain-containing protein 1