PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G225300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 274aa    MW: 29556.3 Da    PI: 8.2949
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G225300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.3e-202079357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  Brast08G225300.1.p 20 TRWCPTAEQLMVLEEMYRGgLRTPNASQIQQITAHLahygRIEGKNVFYWFQNHKARDRQ 79
                        8*****************99*************************************996 PP

2Wus_type_Homeobox117.36.9e-381980364
   Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +tRW+Pt+eQ+++Lee+y+ GlrtPn+++iq+ita+L++yG+ie+kNVfyWFQN+kaR+rqk
  Brast08G225300.1.p 19 TTRWCPTAEQLMVLEEMYRGGLRTPNASQIQQITAHLAHYGRIEGKNVFYWFQNHKARDRQK 80
                        79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.7661580IPR001356Homeobox domain
SMARTSM003893.6E-41784IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.4E-72079IPR009057Homeodomain-like
SuperFamilySSF466895.13E-102080IPR009057Homeodomain-like
PfamPF000461.8E-172079IPR001356Homeobox domain
CDDcd000862.49E-42180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MPAAAAAMAA AAAGTATGTT RWCPTAEQLM VLEEMYRGGL RTPNASQIQQ ITAHLAHYGR  60
IEGKNVFYWF QNHKARDRQK LRRRLCMTHH LLSCAAAAAQ AQAQQAHHYY SPGYHHQLLP  120
GGVPMPHAMA ALQQQQQQQQ YYSAMACRAG GFDQHHHQPL LPVASPMAGA AAGYARCAPA  180
PPPPNSFLQY QQGGSGSPEY SLGRLGSFGV GVDQEEADTC RSTGHVDYQQ QQQQLMAARM  240
EAAAAAETTT FCRAPLKTLD LFPGASVKDE QLA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0401841e-85BT040184.1 Zea mays full-length cDNA clone ZM_BFc0070F13 mRNA, complete cds.
GenBankKJ7269461e-85KJ726946.1 Zea mays clone pUT3492 HB transcription factor (HB82) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566641.31e-103PREDICTED: putative WUSCHEL-related homeobox 2
TrEMBLI1HMF91e-103I1HMF9_BRADI; Uncharacterized protein
STRINGBRADI2G37650.11e-103(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-38WOX family protein