PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G220600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 255aa    MW: 26439.3 Da    PI: 5.1994
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G220600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.95.6e-181859142
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        +rie    rqv fskRr g++KKA+ELSvLC+ e a ++fs+
  Brast08G220600.1.p 18 ERIERPAARQVAFSKRRDGLFKKASELSVLCGPELAAVVFSP 59
                        6899999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.6141058IPR002100Transcription factor, MADS-box
SMARTSM004327.4E-251070IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-221177IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-131232IPR002100Transcription factor, MADS-box
PfamPF003199.8E-211967IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-133247IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-134768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MPLRGSRPSL GRRRIPMERI ERPAARQVAF SKRRDGLFKK ASELSVLCGP ELAAVVFSPG  60
DNKAFSFGSP SVDAVLLATL FANNNNNNAG SSSSSAPAAA LTEAGSSSSP APAAVAAELL  120
GLTKEYEELR AMLEREKLRK GRAEEEMRRQ REAAAGGCPA VAWLDAGLAG LSEADLVELK  180
AALMEVKSAI DVPLAMAPAA PVAMPMMLRG FAGSVCEAGG SSSSSGNKDG AAGPPAMEEM  240
MQQLDLDLVG QIVPA
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G220600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754099.11e-54agamous-like MADS-box protein AGL23
TrEMBLA0A0Q3KAM65e-55A0A0Q3KAM6_BRADI; Uncharacterized protein
STRINGBRADI2G26320.14e-41(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-17AGAMOUS-like 62