PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G215700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 258aa    MW: 28308.4 Da    PI: 8.4849
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G215700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF29.11.3e-091149240
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                         i nk  r+ t+ kR++ + K  +EL vLCd+++ ++++
  Brast08G215700.1.p 11 CIVNKLCRKRTLKKRLASLVKMVSELAVLCDVKAFLVVY 49
                        6889********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-4261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.489249IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-13491IPR002100Transcription factor, MADS-box
CDDcd001208.87E-13461No hitNo description
PfamPF003195.5E-91251IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSPRGPLKLK CIVNKLCRKR TLKKRLASLV KMVSELAVLC DVKAFLVVYI PGEQQPVVWP  60
SAEEATVLAK KYKELSASGK VKELDILTIW KKQVEKHKVK VLNASEANGE RELKAILMRK  120
LNDFFVGQRR SVEDLTPVVS SELGRWIEGL LKDVHKHIEE RRSAPPPAVV DVPEEAVPLL  180
MVAPPLMVEP PPTAIPVVEV QPSHAIEAPL MALDGQPRHG SFLFEVLDAM DVAGDGSGLP  240
TPVELHEVFV RAGLLAP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G215700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233356.11e-132agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3G8C31e-131A0A0Q3G8C3_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5005722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.12e-11AGAMOUS-like 46