PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G215400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 286aa    MW: 31358.2 Da    PI: 5.2265
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G215400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.97.1e-151052244
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                         ien+++r++t+ kR+n ++KK +ELS+LC + ++++++ ++ 
  Brast08G215400.1.p 10 YIENDTKRKTTLKKRLNSLIKKVNELSILCRVMALLVVYRPDE 52
                        59************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.834148IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-15160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-18174IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-8323IPR002100Transcription factor, MADS-box
CDDcd002664.31E-20360No hitNo description
PfamPF003196.9E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MPRGKVRIQY IENDTKRKTT LKKRLNSLIK KVNELSILCR VMALLVVYRP DEEQAVVWPS  60
MTEALAIAEE YTSINSDKLK NALDGQGFLQ QQVDKERGKL QNLQRTAETK RCLHDICIRR  120
DSLKLQGLTL TPEVVGEVRN GLNLQVITEV QCKLQSTLRA VSDRLKDIRS GSTSSAPQQQ  180
GMLPPAELEA PLAPIPQPQE VEMADDFFVA PPAGTDVVPP PPPMPPMETD PPHADDAPMT  240
SLGGLIFHVL NGYDVAGDGS DILAPEELRV MLVRAGINPP PPPNV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G215400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233354.17e-95agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3J4I92e-93A0A0Q3J4I9_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2921224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06500.18e-13AGAMOUS-like 96