PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G191600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 252aa    MW: 26219.7 Da    PI: 8.7472
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G191600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.94.1e-39611611101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++p f   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+
  Brast08G191600.1.p  61 PCAACKLLRRRCAQECPFSPFFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVHALE 151
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         a+la+l++++
  Brast08G191600.1.p 152 ADLAALRAQI 161
                         ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.84960161IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-3961158IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MSIASDWQEH ELGKKIKRES AAAAEADRMM AARRSSSGQL PAAAAAAGAG PGSAPFNTMT  60
PCAACKLLRR RCAQECPFSP FFSPLEPHKF ASVHKVFGAS NVSKMLLEVH ESQRGDAANS  120
LVYEANLRLR DPVYGCMGAI LTLQQQVHAL EADLAALRAQ IHLHHKQQQQ QHTAAALLRP  180
PPPPPTATVA AVLPSSHASQ LLAASTAAGA ARAAMGPAAS ASSSTTVYAA AAASSSTDYS  240
SITHENVPYF G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-386116111111LOB family transfactor Ramosa2.1
5ly0_B7e-386116111111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G191600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-114FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167556.11e-116LOB domain-containing protein 15-like
SwissprotQ9AT612e-62LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A3B5XWC31e-118A0A3B5XWC3_WHEAT; Uncharacterized protein
TrEMBLA0A446IPY71e-118A0A446IPY7_TRITD; Uncharacterized protein
STRINGTraes_1AS_43FB6A3CF.11e-119(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.13e-58LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]