PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G138200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 152aa    MW: 16132.2 Da    PI: 10.4278
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G138200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.85e-132680559
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                        ++ +r+ +NRe+ArrsR+RK++++eeL  ++  L+aeN +   ++  +  e  k+
  Brast08G138200.1.p 26 RKRKRMLSNRESARRSRARKQQRVEELIAEASRLQAENARVEAQVGAYAAELGKV 80
                        57899*********************************99888887777666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-182286IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.4E-122379No hitNo description
PROSITE profilePS5021711.222487IPR004827Basic-leucine zipper domain
PfamPF001701.1E-92675IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.31E-102677No hitNo description
PROSITE patternPS0003602944IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MSSPSRRSSS PESNIGGGSG SAGDERKRKR MLSNRESARR SRARKQQRVE ELIAEASRLQ  60
AENARVEAQV GAYAAELGKV DGENAVLRAR HAELAGRLQA LGGVLEIFQV AGAAVDIPEI  120
PDPLLRPWQS PFAPQLIPAT AAGAMADAFQ F*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13845RRSRARKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G138200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3341281e-159AB334128.1 Triticum aestivum Wlip19d mRNA for basic region/leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569062.13e-71ocs element-binding factor 1
TrEMBLI1HMP77e-70I1HMP7_BRADI; Uncharacterized protein
STRINGBRADI2G38380.11e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-25basic region/leucine zipper motif 53