PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G123600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 255aa    MW: 26204.2 Da    PI: 7.8896
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G123600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.51.1e-4338136199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+
  Brast08G123600.1.p  38 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLHELSPFQREDAVNSLAYEADMRLRDPVYGCVGVISVLQHQLRQLQ 128
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         ++l++++ 
  Brast08G123600.1.p 129 QDLSRARF 136
                         ***99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.63437138IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4338134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MASSSASSLP GSVITVASSA AAAAASGGSG STAATGSPCA ACKFLRRKCQ PDCVFAPYFP  60
PDNPQKFVHV HRVFGASNVT KLLHELSPFQ REDAVNSLAY EADMRLRDPV YGCVGVISVL  120
QHQLRQLQQD LSRARFELAR YQQQAAADFG GSANHNCTQN FINISHHHST TAIGAGVVAG  180
GGGFGGHDQF AAVQMLARSY EGESGAIARL SVNGGYDFGY SSAMGGGVGP VSGLGGPFLK  240
PGTAGGDERH TAAQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-55311514121LOB family transfactor Ramosa2.1
5ly0_B8e-55311514121LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G123600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1349331e-136AC134933.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0579A05, complete sequence.
GenBankAC1376171e-136AC137617.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0084P24, complete sequence.
GenBankAP0149611e-136AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568446.11e-122LOB domain-containing protein 6
RefseqXP_010231373.11e-122LOB domain-containing protein 6
RefseqXP_024314121.11e-122LOB domain-containing protein 6
RefseqXP_024314122.11e-122LOB domain-containing protein 6
SwissprotQ32SG31e-104LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLI1HJD81e-121I1HJD8_BRADI; Uncharacterized protein
STRINGBRADI2G25270.11e-122(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-53LBD family protein