PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G121500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 644aa    MW: 68541.9 Da    PI: 7.4996
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G121500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.99.4e-13171231363
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         + +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++ +  e a+l++++
  Brast08G121500.1.p 171 DTRRAARLIRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSKISFIVAENATLRQQL 231
                         6799***********************************99******99999999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-15169233IPR004827Basic-leucine zipper domain
PfamPF001706.8E-12171231IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.14171234IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.5E-16173232No hitNo description
SuperFamilySSF579597.74E-12173231No hitNo description
CDDcd147046.62E-20174225No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MAEPALLDPS PFDLRHFPPY LFDPDLHLAG DDLPLENFAA GDGDGCDDLD FDLPVDFSVE  60
DFLLRSPERR DSGEGSAAGS GPTGSSSSPA ASAADSVVAD GSCEVKHEES DEGRSGGAPN  120
WGLKRKQASP AVSSDAAKSR RSGDGEVSPS AWASRAAVES DDGGTVGEGE DTRRAARLIR  180
NRESAQLSRQ RKKRYVEELE EKVKSMHSVI NDLNSKISFI VAENATLRQQ LSSSGGNCPP  240
PGVYPPAPMP GMHFPWVPGY ALRPHGSHVP LVPIPRLKPQ QSVAATKVTK KQENKKAVES  300
KSKTKTKKVA SVSLIGLLLF VLLFGAFLPG FNHNFGMTGG SDSAMFRSFG QPPARVLSVT  360
NHGKGTKGGS NNSDMIDVDS GMMMANGDST EQKHAPNSSE TLPALLYVPR NGKHVKINGN  420
LIIHSVLASE KAVAHTASKH NNGQSDIDHK ETSVAIARHL SLPGNDMKPQ EKSPVDGPLP  480
QWFREGMAGP ILNSGMCSEV FQFDISTASA NSGGVIPASP IVNSSSVNAT QSIPTPPPAY  540
LGKLKNRRIM YNEAIPLTGK TVNNTETFNR TSENSKLADK KPSSSVVVSV LADPREAGDG  600
DRDPRMSPKS LSRIFVVVLL DGVRYVTYSC TLPFKSASPH LVN*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22084314}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G121500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000269|PubMed:22084314}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568456.10.0bZIP transcription factor 39
SwissprotQ6AU900.0BZP39_ORYSJ; bZIP transcription factor 39
TrEMBLI1HJF80.0I1HJF8_BRADI; Uncharacterized protein
STRINGBRADI2G25400.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-87bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  4. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  5. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]