PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G119600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 848aa    MW: 92968.5 Da    PI: 6.2451
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G119600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP111.55.1e-35164238276
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         Cqv+gCead+ e+k yh+rh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  Brast08G119600.1.p 164 CQVPGCEADIRELKGYHKRHRVCLRCAHATAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 238
                         ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.2E-27156225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.359161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-33162241IPR004333Transcription factor, SBP-box
PfamPF031108.8E-27164238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 848 aa     Download sequence    Send to blast
MDASDSGGGS AAADAGEPDW DWNNILEFAI RGDDSLTLPW DDTLGTTEAD PAEEAFLPAP  60
SPVLPVEAEP VAPPPPVEAG GSRRGVRKRD PRLVCPNYLA GIVPCACPEL DEMAAAAEVE  120
EVASELLAGP RKKSRPASRG NGVAAGGGGG TGAAGRGGAA EMKCQVPGCE ADIRELKGYH  180
KRHRVCLRCA HATAVMLDGV QKRYCQQCGK FHILLDFDED KRSCRRKLER HNKRRRRKPD  240
SKGTVEKEAD EQLDLSADGS GGCELREENT DGTTCEMVET VRSNKVLDRE TPVGSEDVLS  300
SPTCTHRSLQ NEQSKSIVTF AASVEGCLGT EQENAKLTNS PTHDTKSVYS SSCPTGRISF  360
KLYDWNPAEF PRRLRNQIFE WLSSMPVELE GYIRPGCTIL TVFIAMPQHM WDQLSEDAAN  420
LVRDLVNAPS SLLLGKGAFF VHVNNMIFQV LKDGATLMST RLEVQAPRIH YVHPTWFEAG  480
KPVELLLCGS SLDQPKFRSL LSFDGEYLKH DCCRLMSHET IACVKNAAAL DSQHEIFRIN  540
ITQTKADTHG PGFVEVENII GLSNFVPILF GSKQLCSELE RIQDALCGSD EKYKSVFGEV  600
PGATSDPCGH RELKQTAMSG FLIEIGWLIR KSSPDELKNL LSSTNIKRWT CVLKFLIQND  660
FINVLEIIVK SSDNIIGSEI LSNLERGRLE HHVTTFLGYV RHARNIVGDR AKYEKQTQLE  720
TRWCGDSASN QPNLGISVPF AKENTGAGGE YDLRPTNVEC KEEERMLLAT KAVSHRQCCR  780
PEMNARWLNP TLGAPFPGGA MRTRLVTTVV VAAVLCFAAC VVVFHPDRVG VLAAPVKRYL  840
FSDSPSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-38163245587squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220238KRSCRRKLERHNKRRRRKP
2224236RRKLERHNKRRRR
3231238NKRRRRKP
4232237KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G119600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566250.10.0squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLI1HJH80.0I1HJH8_BRADI; Uncharacterized protein
STRINGBRADI2G25580.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-139squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]