PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G111800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 248aa    MW: 26356.4 Da    PI: 7.5515
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G111800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76e-14165217355
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+e  +L  e ee +++
  Brast08G111800.1.p 165 ATQRQKRMIKNRESAARSRERKQAYIAELEAQVTQLEEEHAELLREQEEQNEK 217
                         679*************************************9988776655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-10162228IPR004827Basic-leucine zipper domain
PfamPF001704.9E-12165224IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.944165229IPR004827Basic-leucine zipper domain
CDDcd147072.99E-18167214No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-13168224No hitNo description
SuperFamilySSF579595.55E-11168215No hitNo description
PROSITE patternPS000360170185IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MASSRVMAAS SQPPRSASSD LARFRSASGI GSMNMDDILR NIYGETPPAG AGVASGEPSP  60
APEAAARRTA EEVWKEISAT GGLSAPVPAP APAGAGGGDG GGASVMTLED FLAREEDARV  120
TAVEGNMAVG FPDGAEGVVG GRRRGGGGGG RGRKRAPMDP MDRAATQRQK RMIKNRESAA  180
RSRERKQAYI AELEAQVTQL EEEHAELLRE QEEQNEKRLN ELKEQAFQVV IRKKPSQDLR  240
RTNSMEW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147GGRRRGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2243730.0KT224373.1 Triticum aestivum cultivar RAC875 bZIP2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568373.11e-173PREDICTED: G-box-binding factor 4
TrEMBLA0A0Q3G4201e-173A0A0Q3G420_BRADI; Uncharacterized protein
STRINGBRADI2G24120.31e-168(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.16e-17G-box binding factor 4