PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G025500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 1836aa    MW: 204157 Da    PI: 5.0165
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G025500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.2e-1947101357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         kR   t++qle+Le+ ++ ++yp++++r eLA++l+Lt+rq ++WF+ rR k++k
  Brast08G025500.1.p  47 KRVMKTPYQLEVLEKTYADDPYPNEATRVELAARLSLTDRQLQMWFCHRRLKDRK 101
                         89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1832102IPR009057Homeodomain-like
SuperFamilySSF466891.2E-1732102IPR009057Homeodomain-like
PROSITE profilePS5007117.02242102IPR001356Homeobox domain
SMARTSM003894.0E-1844106IPR001356Homeobox domain
PfamPF000461.8E-1647101IPR001356Homeobox domain
CDDcd000861.38E-1547102No hitNo description
PROSITE profilePS5082715.292593652IPR018501DDT domain
SMARTSM005713.0E-15593652IPR018501DDT domain
PfamPF027913.6E-16595649IPR018501DDT domain
PfamPF050662.5E-15774841IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156125.8E-99961038IPR028942WHIM1 domain
PfamPF156133.5E-1311731245IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1836 aa     Download sequence    Send to blast
MDSSGDGGDE GAGAAPGSPA PAPSSAPAAA AAGGAAASGS SSRPTAKRVM KTPYQLEVLE  60
KTYADDPYPN EATRVELAAR LSLTDRQLQM WFCHRRLKDR KQPAKQEEEV AVPVAVSPSL  120
PQPSLPNSKL APGSSSTYSE QLLPCSQRGR GRSSAVPRIS ASEIARRYYE PHQVMLPPLA  180
AVQPTQGAHQ MIDYVQQLIG KPLREDGPVL GVHFDPLPPG AFGAPIVQEQ RKQPFRSYET  240
KASVFLPTID PSVPSTVTRK RKSMDGNSSH LGSRAVREYQ FLPEQPSTYE RPSQQRFYDA  300
PTEASNSRIS SVSTGSRFLH GAEQEPSYAF HGQISGPSHL SQHGKPLIFP SGSTDYETAS  360
SYINVSSAPM EGQFGIPQVA GFETPLACSE GVDYRCEDAY RLDKKRKHKE EAKIGKEVDV  420
HEKRIRKELE KQDLLKRKKE EQMRREMERH GREKRKEEEK FMREKQREEE RLQKEQWREH  480
KRKEKFLLKQ SLRDEKLRQK EELRKEKEAA RQKAANEKAT ARRIAREYLE LMEDERLELM  540
ELVSRSKGLP SMLSLDSDTL QQLDSFRGML TQFPNEVVRL KIPFSVKPWM NSESNIGSLL  600
MVWKFFFTFA DVLGLPSFTL DEFVQSLHDY DSRLLAELHV ALLKSIIKDI ENVARTSSDA  660
FGVNQSSSAN PGGGHPQIVE GAYAWGFNIL TWQRHLTYHT WPEILRQFGL SAGFGPQLKK  720
RSAEDVYCHD DNEGRNTQDV ISTLRNGSAA LKSAALMKER GYTNRRSRHR LTPGTVKFAA  780
FHVLSLEGDK GLSILEVAEK IQKSGLRDLT TSKTPEASIS AALSRDTKLF ERTAPSTYCV  840
KTPYRKDPAD SEAVLSAARE KIKVFQNVLS ECEEVEKDVD DAERGDDDSE CDDADDDPDG  900
DEVNVEEKNA EVSVLRAQDG GIPTLPCDIN DELNSVGNTS MPSSPHNRSQ SNLLGMLDET  960
TAASTSSDPP IGASSAYHEV ATDSAQDTEI DESNQGESWV EGLAEGDYGD LSVEERLDAL  1020
VALVNVATEG NSMRAILEER LEAANALKKQ MWAESQLDKR RSREDFAGKI QHDSCTGFKA  1080
IADQENSVGE CNLTPVQNLT KENDGNTSSV NNDLLVDQHS QLNAGNMVHE VNGLSRESNP  1140
ESLSVQQYAS SDKTRSQLKS FIGHKAEQLY VYRSLPLGQD RRRNRYWQFS ASASPNDPGS  1200
GRIFFESRDG YWRLIDSAEA FDALVASLDT RGIRESHLHS MLQNIESTFK DAIGRRKCAT  1260
IEHPAGMILR NGSSEIISPN HSNEFGSPCS TLSGVVCDNA MVYSDSFKIE LGRNDLEKVA  1320
ILKRASMFLK WMWRERNNHQ STCAMKYGKK RCSELIQPCD FCYQIYPTEE MHCSSCHKSF  1380
KSIQSLSEHA SQCDEKQRTD PDLKMQISDD SIPIRLRLLK LLLASIEVSV PAEALLPFWT  1440
DGYRKSWGLK LYSTSSTKEV FQMLTVLEGA IRRNYLSSNF KTTAELLNST ARDNSNQNFV  1500
ACSGSADVLP WVPNTAAAVT LRLLDLDSAL SYTSDQKAVL TKEQESPDSM KFPSRCLAVK  1560
NKQEMESVGA TGLDQRDEAW LTPSTGHRGR GRGGRGRGRG GRSRSRGGRV PRGIGSSPKI  1620
EFRDDNNVSL KVPYKQAPRG RGRGRGRGRG LRTVRPRQPT EHGSGSVPKA NLLGSFRMLS  1680
NAKPTTVHSP QSSGAEEWGF ERRAYVEDDE SNSVSQSEES EENEENGEPM DEDYNEQLPD  1740
YSRDNSGSSP LQMMDDGSEN DEEDDEEVED DGVDYDAEDP LDEDNNDAEM SGNDELHNDE  1800
DDDDNDGDDA GGVQDEVENT DDDEDGASDS SEYSE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257262TRKRKS
2435455KRKKEEQMRREMERHGREKRK
316381648RGRGRGRGRGR
416401649RGRGRGRGRG
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G025500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565920.10.0homeobox-DDT domain protein RLT2 isoform X2
TrEMBLA0A0Q3FZZ50.0A0A0Q3FZZ5_BRADI; Uncharacterized protein
STRINGBRADI2G16647.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator