PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G235800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 271aa    MW: 28648.1 Da    PI: 6.7176
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G235800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.28.7e-0996141752
                         HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                          rr   NR A r++R++Kka ++ Lee+v +L+a Nk+L k++++ 
  Brast07G235800.1.p  96 KRRPSGNRAAVRKYREKKKAHTALLEEEVVQLKALNKELMKKVQNH 141
                         577778**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-990157IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.692139IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-793141No hitNo description
PfamPF077161.3E-1294145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.1E-1394158No hitNo description
CDDcd146862.23E-1295149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDDGDLDFNP DTYLCSGAAA AGGTETPGAC SMDSYFDEIL KDTEHLACTH THTCNPPVHD  60
LSHTHTCVHV HTKIVSASSD GADSPAENTT SGTSKKRRPS GNRAAVRKYR EKKKAHTALL  120
EEEVVQLKAL NKELMKKVQN HAALEAEVAR LRCLLVDIRG RIEGEIGAFP YHRPVKNVDL  180
VSGVDLVGAG SQVLNSCDFR CNDQLYCNPG MQMRAVGDDG AMNGQAFGQG TGDFVNVQCL  240
GSAKSGSTIS PGCGGMGNAP FGCLPNAGRK *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast07G235800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563276.10.0basic leucine zipper 23
TrEMBLI1GVB00.0I1GVB0_BRADI; Uncharacterized protein
STRINGBRADI1G30140.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-68bZIP family protein