PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G229500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 281aa    MW: 28973.3 Da    PI: 9.8313
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G229500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.31.6e-081742162163
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         R RKk+++ e ++ v +L aeN+ L++e+e+l+  +++l  e+
  Brast07G229500.1.p 174 RSRKKMRLPEVQQLVRSLAAENDGLREEVESLQRACSALSREN 216
                         99***********************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.5E-6173213No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MAEVDEEPCL AVLAEAEAAG IICSLRAGDL AGWTPPWTTT GGPPSEALVA EPAKEEEGEA  60
GGGWPAVTRG KRSRRRSPSG GSAADGKTGK KKKRRRRARG SPASPLDCGA ASASASASGA  120
STSGAEDGAF CSPEPPPAAA VAQAVPSAAQ ASSAKVCSAG VRRPPPRPTA AGPRSRKKMR  180
LPEVQQLVRS LAAENDGLRE EVESLQRACS ALSRENGTLE TRLEHSSSKR KRTVSEEQDR  240
RRQRKPTLQL AAEHRGAPNG FVLPDLNIPA AAPDDVGSAP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17395RRRSPSGGSAADGKTGKKKKRRR
28994KKKKRR
39095KKKRRR
49096KKKRRRR
59196KKRRRR
6173179RSRKKMR
7238245DRRRQRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast07G229500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560357.13e-98trinucleotide repeat-containing gene 18 protein
TrEMBLI1GVI68e-97I1GVI6_BRADI; Uncharacterized protein
STRINGBRADI1G30750.11e-97(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951