PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G218200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 297aa    MW: 31699.4 Da    PI: 6.6212
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G218200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.85.7e-14131183355
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         + kr rr+ +NRe+ArrsR+RK a++  Le  v++L++e  +L k+l e +++
  Brast07G218200.1.p 131 DTKRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESASLFKQLTEANQH 183
                         579****************************************9888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-14129193IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.634131182IPR004827Basic-leucine zipper domain
PfamPF001701.6E-11132183IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.45E-10133184No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-11133183No hitNo description
PROSITE patternPS000360136151IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MKKCASELEL EAFIRQHLAS AAANRPSQGT DAGAGVFSSH VGGLPVPGLC FGDSQNALEL  60
EGSDAGHLWW SDGVCAPHPA ASSTMGSQTA AASAGHTETT SGNQALESES DSGTESLIDI  120
EGGRCNRKST DTKRIRRMVS NRESARRSRR RKHAQLTDLE LQVEQLKSES ASLFKQLTEA  180
NQHFTTAVTD NRILKSDVET LRVKVKMAED MVARTAMSCG VGQLGLAPFL NSRKMCQALD  240
VLTATGLDLP GNRALFKDLT PSRQVQTSTV QSTASLESLD NRMSSEVTSC AGDMWP*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). May function as a negative regulator in cold and drought stress responses (PubMed:22189955). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:22189955}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast07G218200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by cold stress in roots. {ECO:0000269|PubMed:22189955}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240308.11e-175bZIP transcription factor RISBZ5 isoform X1
SwissprotQ654B32e-85RSBZ5_ORYSJ; bZIP transcription factor RISBZ5
TrEMBLI1GVU41e-173I1GVU4_BRADI; Uncharacterized protein
STRINGBRADI1G31700.11e-174(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-29basic leucine zipper 9
Publications ? help Back to Top
  1. Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F
    A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif.
    J. Biol. Chem., 2001. 276(17): p. 14139-52
    [PMID:11133985]
  2. Liu C,Wu Y,Wang X
    bZIP transcription factor OsbZIP52/RISBZ5: a potential negative regulator of cold and drought stress response in rice.
    Planta, 2012. 235(6): p. 1157-69
    [PMID:22189955]